SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g01490

Feature Type:gene_model
Chromosome:Gm04
Start:981932
stop:982930
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g01490
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G49310AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 9 plant structures; EXPRESSED DURING: LP.04 four leaves visible, petal differentiation and expansion stage; Has 11 Blast hits to 11 proteins in 6 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 11; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:18237997-18238325 REVERSE LENGTH=82 SoyBaseE_val: 4.00E-11ISS
GO:0000041GO-bp Annotation by Michelle Graham. GO Biological Process: transition metal ion transport SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF10950PFAM Protein of unknown function (DUF2775) JGI ISS
UniRef100_I1JSP8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JSP8_SOYBN SoyBaseE_val: 5.00E-65ISS
UniRef100_Q9FUP6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Suspensor-specific protein n=1 Tax=Phaseolus coccineus RepID=Q9FUP6_PHACN SoyBaseE_val: 2.00E-40ISS

Expression Patterns of Glyma04g01490
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g01490
ParalogEvidenceComments
Glyma06g01550 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g01490 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g013400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g01490
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g01490
>Glyma04g01490.1   sequence type=CDS   gene model=Glyma04g01490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGTCCAATTTTGCTGTTTTCGTAGTCTTCTCTCTTCTCCTGATTGCCAACTTGAGCTGTGCAAGGAAAGACCTGGGATGGTATTGGAAGAATGTGATGAAGGAGCAACCTATGCCACAAGCAATTAAAGACCTTGTTGAGGATTCACAAGCATCAGCTGCAGGGAAGAAGGATCGTTTTATCAGGGACTTCGATGTAAAGCCTAATGTCATATTATATCACACCCATGTTGTGCCCATGAAGCAGAAGCATAAGCATAAGCAGAATCCTTTTGTCAAGAATCAAGATTGA
Predicted protein sequences of Glyma04g01490
>Glyma04g01490.1   sequence type=predicted peptide   gene model=Glyma04g01490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKSNFAVFVVFSLLLIANLSCARKDLGWYWKNVMKEQPMPQAIKDLVEDSQASAAGKKDRFIRDFDVKPNVILYHTHVVPMKQKHKHKQNPFVKNQD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo