SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g01421

Feature Type:gene_model
Chromosome:Gm04
Start:913245
stop:914773
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g01421
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G21660AT Annotation by Michelle Graham. TAIR10: cold, circadian rhythm, and rna binding 2 | chr2:9265477-9266316 REVERSE LENGTH=159 SoyBaseE_val: 7.00E-43ISS
GO:0000380GO-bp Annotation by Michelle Graham. GO Biological Process: alternative mRNA splicing, via spliceosome SoyBaseN/AISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006406GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA export from nucleus SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0006970GO-bp Annotation by Michelle Graham. GO Biological Process: response to osmotic stress SoyBaseN/AISS
GO:0006972GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic response SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0007623GO-bp Annotation by Michelle Graham. GO Biological Process: circadian rhythm SoyBaseN/AISS
GO:0009266GO-bp Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0010043GO-bp Annotation by Michelle Graham. GO Biological Process: response to zinc ion SoyBaseN/AISS
GO:0010119GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of stomatal movement SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0010501GO-bp Annotation by Michelle Graham. GO Biological Process: RNA secondary structure unwinding SoyBaseN/AISS
GO:0032508GO-bp Annotation by Michelle Graham. GO Biological Process: DNA duplex unwinding SoyBaseN/AISS
GO:0045087GO-bp Annotation by Michelle Graham. GO Biological Process: innate immune response SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005777GO-cc Annotation by Michelle Graham. GO Cellular Compartment: peroxisome SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0003690GO-mf Annotation by Michelle Graham. GO Molecular Function: double-stranded DNA binding SoyBaseN/AISS
GO:0003697GO-mf Annotation by Michelle Graham. GO Molecular Function: single-stranded DNA binding SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0003729GO-mf Annotation by Michelle Graham. GO Molecular Function: mRNA binding SoyBaseN/AISS
KOG0107 KOG Alternative splicing factor SRp20/9G8 (RRM superfamily) JGI ISS
PTHR24012Panther FAMILY NOT NAMED JGI ISS
PTHR24012:SF31Panther SUBFAMILY NOT NAMED JGI ISS
PF00076PFAM RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) JGI ISS
UniRef100_G7JHA8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glycine-rich RNA binding protein n=1 Tax=Medicago truncatula RepID=G7JHA8_MEDTR SoyBaseE_val: 7.00E-44ISS
UniRef100_UPI000233A07EUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A07E related cluster n=1 Tax=unknown RepID=UPI000233A07E SoyBaseE_val: 1.00E-110ISS

Expression Patterns of Glyma04g01421
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g01421 not represented in the dataset
Glyma04g01421 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g01421
ParalogEvidenceComments
Glyma06g01471 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g01421 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g012700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g01421
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g01421
>Glyma04g01421.1   sequence type=CDS   gene model=Glyma04g01421   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCTGAAGTAATAGAGTACCGATGCTTTGTCGGTGGGCTTGCTTGGGCCACCGACAGCGATGCTCTCGAGAAAGCCTTCTCTCATTATGGTGAGATCGTCGAATCGAAGGTTATCATCGATCGTGAAACTGGAAGATCGAGAGGGTTTGGATTTGTGACCTTCGCCTCGGAGCAGGCGATGAAAGACGCAATCGAAGGAATGAACGGTCAGAACCTCGACGGTCGTAGTATCACAGTGAACGAAGCACAATCCCGTGGAAGAGGCGGTGGTGGCGGTGGATACGGAGGTGGTGGTGGTTATGGCGGCGGCGGTTACAGCCGCGGTGGAGGAGGATATGGAGGAGGAGGCCGCCGTGAAGGTGGTGGAGGTGGCTATAACCGCAACGGTGGAGGTGGTGGATATGGTGGTGGTGGAGGTTATGGTGGTGGTGGAGGTCATGGTGGCGGTGGAGGTTATGGTGGCGGTGGGAGAGACCGTGGATATGGTGGTGACGGCGGGTCCCGCTACTCGAGAGGAGGCGGTGCTTCGGATGGAGGAAGCTGGAGGAATTAG
Predicted protein sequences of Glyma04g01421
>Glyma04g01421.1   sequence type=predicted peptide   gene model=Glyma04g01421   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASEVIEYRCFVGGLAWATDSDALEKAFSHYGEIVESKVIIDRETGRSRGFGFVTFASEQAMKDAIEGMNGQNLDGRSITVNEAQSRGRGGGGGGYGGGGGYGGGGYSRGGGGYGGGGRREGGGGGYNRNGGGGGYGGGGGYGGGGGHGGGGGYGGGGRDRGYGGDGGSRYSRGGGASDGGSWRN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo