|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G75250 | AT | Annotation by Michelle Graham. TAIR10: RAD-like 6 | chr1:28245073-28245453 REVERSE LENGTH=126 | SoyBase | E_val: 1.00E-32 | ISS |
| GO:0006355 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0003677 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA binding | SoyBase | N/A | ISS |
| GO:0003700 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity | SoyBase | N/A | ISS |
| PTHR25040 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PTHR25040:SF164 | Panther | JGI | ISS | ||
| PF00249 | PFAM | Myb-like DNA-binding domain | JGI | ISS | |
| UniRef100_G7J732 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: DnaJ homolog subfamily C member n=1 Tax=Medicago truncatula RepID=G7J732_MEDTR | SoyBase | E_val: 2.00E-43 | ISS |
| UniRef100_I1JSP1 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JSP1_SOYBN | SoyBase | E_val: 2.00E-46 | ISS |
|
Glyma04g01410 not represented in the dataset |
Glyma04g01410 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.04g012600 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma04g01410.2 sequence type=CDS gene model=Glyma04g01410 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCCTCCAGCACTTTGAGCAAACAAAAGCCTTATGATTCGTGTTGGACCCCAAAACAGAACAAGGTGTTTGAAAAGGCACTTGCAAAGTATGACAAGGATACCCCTGACCGCTGGCACAATGTAGCCAAAGCAATTGGTGGTAAATCAGAAGATGATGTTAAGAGACACTATCAGATACTCTTGGAGGATCTCAGGCACATTGAGTCTGGCCATGTTCCCATTCCCAATTACAAATCAACACCAACTACCTTTCCTCTTTCAACAACACTCGTAGGCTTCTGA
>Glyma04g01410.2 sequence type=predicted peptide gene model=Glyma04g01410 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MASSTLSKQKPYDSCWTPKQNKVFEKALAKYDKDTPDRWHNVAKAIGGKSEDDVKRHYQILLEDLRHIESGHVPIPNYKSTPTTFPLSTTLVGF*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||