Glyma04g01410 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g01410

Feature Type:	gene_model
Chromosome:	Gm04
Start:	902435
stop:	903584
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g01410

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G75250	AT	Annotation by Michelle Graham. TAIR10: RAD-like 6 \| chr1:28245073-28245453 REVERSE LENGTH=126	SoyBase	E_val: 1.00E-32	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
PTHR25040	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR25040:SF164	Panther		JGI		ISS
PF00249	PFAM	Myb-like DNA-binding domain	JGI		ISS
UniRef100_G7J732	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DnaJ homolog subfamily C member n=1 Tax=Medicago truncatula RepID=G7J732_MEDTR	SoyBase	E_val: 2.00E-43	ISS
UniRef100_I1JSP1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JSP1_SOYBN	SoyBase	E_val: 2.00E-46	ISS

Expression Patterns of Glyma04g01410

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g01410 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g012600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g01410

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g01410

Limit To All Plant Sequences

>Glyma04g01410.2   sequence type=CDS   gene model=Glyma04g01410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTCCAGCACTTTGAGCAAACAAAAGCCTTATGATTCGTGTTGGACCCCAAAACAGAACAAGGTGTTTGAAAAGGCACTTGCAAAGTATGACAAGGATACCCCTGACCGCTGGCACAATGTAGCCAAAGCAATTGGTGGTAAATCAGAAGATGATGTTAAGAGACACTATCAGATACTCTTGGAGGATCTCAGGCACATTGAGTCTGGCCATGTTCCCATTCCCAATTACAAATCAACACCAACTACCTTTCCTCTTTCAACAACACTCGTAGGCTTCTGA

Predicted protein sequences of Glyma04g01410

Limit To All Plant Sequences

>Glyma04g01410.2   sequence type=predicted peptide   gene model=Glyma04g01410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASSTLSKQKPYDSCWTPKQNKVFEKALAKYDKDTPDRWHNVAKAIGGKSEDDVKRHYQILLEDLRHIESGHVPIPNYKSTPTTFPLSTTLVGF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain