SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g01311

Feature Type:gene_model
Chromosome:Gm04
Start:839082
stop:841310
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g01311
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G17080AT Annotation by Michelle Graham. TAIR10: Arabidopsis protein of unknown function (DUF241) | chr2:7433326-7434117 REVERSE LENGTH=263 SoyBaseE_val: 7.00E-38ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF03087PFAM Arabidopsis protein of unknown function JGI ISS
UniRef100_B0BLI0UniRef Annotation by Michelle Graham. Most informative UniRef hit: CM0216.320.nc protein n=1 Tax=Lotus japonicus RepID=B0BLI0_LOTJA SoyBaseE_val: 5.00E-70ISS
UniRef100_I1K763UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K763_SOYBN SoyBaseE_val: 2.00E-105ISS

Expression Patterns of Glyma04g01311
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g01311 not represented in the dataset
Glyma04g01311 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g01311
ParalogEvidenceComments
Glyma06g01370 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g01311 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g011500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g01311
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g01311
>Glyma04g01311.1   sequence type=CDS   gene model=Glyma04g01311   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTCAAACTTGACGAATTGTTGGATTTGCATGACTGCACTTATAAGTTGCTTCAAGTGCCAACGAAACAACAAGCCTTGGCACGAGAATGCACTAAAGAGTGTCTATTGATATTAAAGGAAAGCATGCACGAACTTCACTCTGTCATCCGAAAAAGGAAAGGTGATAAAACTATTTTCACAATTGAGGGTGGAAAATACTTGGCTTCAAGGAACAAGTTGAAGAAGAAAATTAGAAAGGCCTTGAGAAATTTGAAAGCCATGAAAAGTGAGTTTCACAATTTTTCAATGCTTAGCATCTTAACAGAAGCAGAAGAGGTCACATTGAGGTCATTAGAATCTTTGTTGTTGTTTATCTGTGACCCCAAGGGACAACCAAAGCAAAGCAGATGGTCAGCAATCTCAAAGCTGATGCATCCTAAAAGAATGGTTTATGACTCTCAAGAATCACGCACAAATGAATTTGACAAGGTGGATGCAGCTTTTCACAAGCTTTCATCTATTGAGTACCTTCTAAGCCATATTGAAAATTTGGAGATGTGCATTCAGGATCTACAAATAGGAGTTGAGCACCTCACAAGAAAACTAATTAGGAACAGAATTTCCCTTCTCAACATATTCAACCACTAA
Predicted protein sequences of Glyma04g01311
>Glyma04g01311.1   sequence type=predicted peptide   gene model=Glyma04g01311   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LKLDELLDLHDCTYKLLQVPTKQQALARECTKECLLILKESMHELHSVIRKRKGDKTIFTIEGGKYLASRNKLKKKIRKALRNLKAMKSEFHNFSMLSILTEAEEVTLRSLESLLLFICDPKGQPKQSRWSAISKLMHPKRMVYDSQESRTNEFDKVDAAFHKLSSIEYLLSHIENLEMCIQDLQIGVEHLTRKLIRNRISLLNIFNH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo