Glyma04g01252 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g01252

Feature Type:	gene_model
Chromosome:	Gm04
Start:	812694
stop:	814457
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g01252

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G38020	AT	Annotation by Michelle Graham. TAIR10: S-adenosyl-L-methionine-dependent methyltransferases superfamily protein \| chr5:15165953-15167612 REVERSE LENGTH=368	SoyBase	E_val: 3.00E-80	ISS
GO:0006633	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process	SoyBase	N/A	ISS
GO:0010089	GO-bp	Annotation by Michelle Graham. GO Biological Process: xylem development	SoyBase	N/A	ISS
GO:0044036	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell wall macromolecule metabolic process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0008168	GO-mf	Annotation by Michelle Graham. GO Molecular Function: methyltransferase activity	SoyBase	N/A	ISS
GO:0008757	GO-mf	Annotation by Michelle Graham. GO Molecular Function: S-adenosylmethionine-dependent methyltransferase activity	SoyBase	N/A	ISS
PF03492	PFAM	SAM dependent carboxyl methyltransferase	JGI		ISS
UniRef100_G7J763	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Salicylic acid/benzoic acid carboxyl methyltransferase n=1 Tax=Medicago truncatula RepID=G7J763_MEDTR	SoyBase	E_val: 1.00E-134	ISS
UniRef100_UPI000233A69B	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233A69B related cluster n=1 Tax=unknown RepID=UPI000233A69B	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma04g01252

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g01252 not represented in the dataset	Glyma04g01252 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g01252

Paralog	Evidence	Comments
Glyma06g01293	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g01252 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g010900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g01252

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g01252

Limit To All Plant Sequences

>Glyma04g01252.1   sequence type=CDS   gene model=Glyma04g01252   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAACAGTGCAATTCATTTTCGCTAATGGTGGTTCGGGAGAAGCTAGCTACGCAAACAATTCCTCCTTTCAAAGTCAGATGATATCAAAAGTGAAGCCCATACTGGAAGAAAGTATGATGACCCTGTATTGCAACTCAGTCCCATGCTGTTTCAAAGTGGCCGATTTAGGTTGCTCTTCAGGACCAAATGCACTTCAGGTGGCATATGATATTATTGATGTTGTTGATAACATAAGTAGCAGCTTTAACCGTGAGCCACCCACATTCCAAATTTACCTCAACGATCAATTTCAAAACGATTTCAACAACATCTTTGAGTCCCTACCTTACTTCTATGAAAGGCTACGACAAGAGAAGGGAGAGAAGTTTAGTCCATTTTTCATTAATGCAACGCCCGGAAGCTTTTATGGGAGACTCTTCCCAAGCAATTCCATGCACTTTTTTCATTCTTCCACCAGCCTTCATTGGCTCTCTCAGGCTCCAAAGGGGTTGGCTAAGGAAACAGGATTGGTTAACAAGGGAAACATTTACTTCACAAACACAAGCCCATCCGAAGTGTACCAAGCATACCTTGACCAGTTTAGTCAAGATTTCAATCTGTTTCTAAAATCACGTGCGGAGGAATTAGTGCGTGGTGGTGGCATGGTTCTAACATTTGTTGGTAGAGATGAAACTTGTGACATAATCACTCCTTGGGGGTTAATTGGTTTGGTTCTCAATGACATGGTTTCAGAGAGTTTGGTTGAAGAGGCAAAGTTGGAGTATGTTAATATGCCAAGATATGGTCCTACTGCAAAGGAAGTGAAACAATTGATCGATGCAGAAGGGTCTTTCACTCTTGAGAAGTTGGAGACATTCAAGTCGCGTTGGGATGAGGGCTTGAAGGAGAATGGTAATGGTGATTTCGTATTAGACACAAATGTCAGAGCCAATTTCATAGCCAAATATGTGAGAGCTACTACCGAACCTTTCCTGACGGCACGGTTTGGAGAAGGAATAATTGATGAATTATTCATTAGATTTAGAAAGAAGGTTGCGGAACTATTGGAAGAAGTGATATTAGAGCATGCTTACCTGGTCATGTTTATGACAAAAAAATGA

Predicted protein sequences of Glyma04g01252

Limit To All Plant Sequences

>Glyma04g01252.1   sequence type=predicted peptide   gene model=Glyma04g01252   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATVQFIFANGGSGEASYANNSSFQSQMISKVKPILEESMMTLYCNSVPCCFKVADLGCSSGPNALQVAYDIIDVVDNISSSFNREPPTFQIYLNDQFQNDFNNIFESLPYFYERLRQEKGEKFSPFFINATPGSFYGRLFPSNSMHFFHSSTSLHWLSQAPKGLAKETGLVNKGNIYFTNTSPSEVYQAYLDQFSQDFNLFLKSRAEELVRGGGMVLTFVGRDETCDIITPWGLIGLVLNDMVSESLVEEAKLEYVNMPRYGPTAKEVKQLIDAEGSFTLEKLETFKSRWDEGLKENGNGDFVLDTNVRANFIAKYVRATTEPFLTARFGEGIIDELFIRFRKKVAELLEEVILEHAYLVMFMTKK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain