SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma04g01252

Feature Type:gene_model
Chromosome:Gm04
Start:812694
stop:814457
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G38020AT Annotation by Michelle Graham. TAIR10: S-adenosyl-L-methionine-dependent methyltransferases superfamily protein | chr5:15165953-15167612 REVERSE LENGTH=368 SoyBaseE_val: 3.00E-80ISS
GO:0006633GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process SoyBaseN/AISS
GO:0010089GO-bp Annotation by Michelle Graham. GO Biological Process: xylem development SoyBaseN/AISS
GO:0044036GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall macromolecule metabolic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0008168GO-mf Annotation by Michelle Graham. GO Molecular Function: methyltransferase activity SoyBaseN/AISS
GO:0008757GO-mf Annotation by Michelle Graham. GO Molecular Function: S-adenosylmethionine-dependent methyltransferase activity SoyBaseN/AISS
PF03492PFAM SAM dependent carboxyl methyltransferase JGI ISS
UniRef100_G7J763UniRef Annotation by Michelle Graham. Most informative UniRef hit: Salicylic acid/benzoic acid carboxyl methyltransferase n=1 Tax=Medicago truncatula RepID=G7J763_MEDTR SoyBaseE_val: 1.00E-134ISS
UniRef100_UPI000233A69BUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A69B related cluster n=1 Tax=unknown RepID=UPI000233A69B SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g01252 not represented in the dataset

Glyma04g01252 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma06g01293 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g010900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g01252.1   sequence type=CDS   gene model=Glyma04g01252   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAACAGTGCAATTCATTTTCGCTAATGGTGGTTCGGGAGAAGCTAGCTACGCAAACAATTCCTCCTTTCAAAGTCAGATGATATCAAAAGTGAAGCCCATACTGGAAGAAAGTATGATGACCCTGTATTGCAACTCAGTCCCATGCTGTTTCAAAGTGGCCGATTTAGGTTGCTCTTCAGGACCAAATGCACTTCAGGTGGCATATGATATTATTGATGTTGTTGATAACATAAGTAGCAGCTTTAACCGTGAGCCACCCACATTCCAAATTTACCTCAACGATCAATTTCAAAACGATTTCAACAACATCTTTGAGTCCCTACCTTACTTCTATGAAAGGCTACGACAAGAGAAGGGAGAGAAGTTTAGTCCATTTTTCATTAATGCAACGCCCGGAAGCTTTTATGGGAGACTCTTCCCAAGCAATTCCATGCACTTTTTTCATTCTTCCACCAGCCTTCATTGGCTCTCTCAGGCTCCAAAGGGGTTGGCTAAGGAAACAGGATTGGTTAACAAGGGAAACATTTACTTCACAAACACAAGCCCATCCGAAGTGTACCAAGCATACCTTGACCAGTTTAGTCAAGATTTCAATCTGTTTCTAAAATCACGTGCGGAGGAATTAGTGCGTGGTGGTGGCATGGTTCTAACATTTGTTGGTAGAGATGAAACTTGTGACATAATCACTCCTTGGGGGTTAATTGGTTTGGTTCTCAATGACATGGTTTCAGAGAGTTTGGTTGAAGAGGCAAAGTTGGAGTATGTTAATATGCCAAGATATGGTCCTACTGCAAAGGAAGTGAAACAATTGATCGATGCAGAAGGGTCTTTCACTCTTGAGAAGTTGGAGACATTCAAGTCGCGTTGGGATGAGGGCTTGAAGGAGAATGGTAATGGTGATTTCGTATTAGACACAAATGTCAGAGCCAATTTCATAGCCAAATATGTGAGAGCTACTACCGAACCTTTCCTGACGGCACGGTTTGGAGAAGGAATAATTGATGAATTATTCATTAGATTTAGAAAGAAGGTTGCGGAACTATTGGAAGAAGTGATATTAGAGCATGCTTACCTGGTCATGTTTATGACAAAAAAATGA

>Glyma04g01252.1   sequence type=predicted peptide   gene model=Glyma04g01252   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATVQFIFANGGSGEASYANNSSFQSQMISKVKPILEESMMTLYCNSVPCCFKVADLGCSSGPNALQVAYDIIDVVDNISSSFNREPPTFQIYLNDQFQNDFNNIFESLPYFYERLRQEKGEKFSPFFINATPGSFYGRLFPSNSMHFFHSSTSLHWLSQAPKGLAKETGLVNKGNIYFTNTSPSEVYQAYLDQFSQDFNLFLKSRAEELVRGGGMVLTFVGRDETCDIITPWGLIGLVLNDMVSESLVEEAKLEYVNMPRYGPTAKEVKQLIDAEGSFTLEKLETFKSRWDEGLKENGNGDFVLDTNVRANFIAKYVRATTEPFLTARFGEGIIDELFIRFRKKVAELLEEVILEHAYLVMFMTKK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo