Report for Sequence Feature Glyma04g01161
Feature Type: gene_model
Chromosome: Gm04
Start: 730026
stop: 731049
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g01161
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
UniRef100_D3YBF9 UniRef
Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Trifolium repens RepID=D3YBF9_TRIRP
SoyBase E_val: 1.00E-45 ISS
Expression Patterns of Glyma04g01161
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma04g01161
Paralog Evidence Comments
Glyma06g01193 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma04g01161 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g009700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g01161
Coding sequences of Glyma04g01161
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g01161.1 sequence type=CDS gene model=Glyma04g01161 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAAATTCTCACATCATTTTTCTCACAATCAGAATTCAGCGTTGGGTTATCTTTCTTTCCCTCTCGGCAATATGGAGCAAGAAATTGACAATTTGATATCAAACATGGGTTCACTTGGAACCAGCTTTCCACCAAAGAGAGGATTGTCAAGGTATTACTCGGGAAAATCAAGATCATTTGTTTGCATGGAAGATGTACATTGCGTGGAGGATTTGAAGAAACCAGAACATTATTCTGATACAAAGAAAAGGAAGAAACGTTCGCACAGAAAGGAATTGCTCAACCTTGCTCCTTATCCATGCCGAAGGGCACCAAGTTGCACTCAATTAACTACCCCATACGTCAACGTGTAG
Predicted protein sequences of Glyma04g01161
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g01161.1 sequence type=predicted peptide gene model=Glyma04g01161 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MKFSHHFSHNQNSALGYLSFPLGNMEQEIDNLISNMGSLGTSFPPKRGLSRYYSGKSRSFVCMEDVHCVEDLKKPEHYSDTKKRKKRSHRKELLNLAPYPCRRAPSCTQLTTPYVNV*