SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g01140

Feature Type:gene_model
Chromosome:Gm04
Start:718193
stop:722026
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g01140
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G39100AT Annotation by Michelle Graham. TAIR10: PHD finger family protein / bromo-adjacent homology (BAH) domain-containing protein | chr4:18218298-18220134 REVERSE LENGTH=228 SoyBaseE_val: 5.00E-117ISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006333GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin assembly or disassembly SoyBaseN/AISS
GO:0006635GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0006972GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic response SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0009266GO-bp Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009791GO-bp Annotation by Michelle Graham. GO Biological Process: post-embryonic development SoyBaseN/AISS
GO:0016558GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into peroxisome matrix SoyBaseN/AISS
GO:0042744GO-bp Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide catabolic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR12505Panther PHD FINGER TRANSCRIPTION FACTOR JGI ISS
PTHR12505:SF8Panther SUBFAMILY NOT NAMED JGI ISS
PF00628PFAM PHD-finger JGI ISS
PF01426PFAM BAH domain JGI ISS
UniRef100_B9RHA1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Phd finger transcription factor, putative n=1 Tax=Ricinus communis RepID=B9RHA1_RICCO SoyBaseE_val: 2.00E-147ISS
UniRef100_C6T2S0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T2S0_SOYBN SoyBaseE_val: 6.00E-161ISS

Expression Patterns of Glyma04g01140
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g01140
ParalogEvidenceComments
Glyma06g01180 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g01140 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g009500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g01140
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g01140
>Glyma04g01140.1   sequence type=CDS   gene model=Glyma04g01140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCAAACCGAAGGCTCCAAGACGAACCCTAGAGTCATACTCAGTCAAACACATAAGCAAAACCATTAGAGCTGGCGATTGCGTGCTCATGCGGCCCTCCGATCTGTCGAAACCGTCGTACGTGGCGAGGATCGAGCGGATCGAAGCCGACGCGCGCGGCTCCAACGTGAAGATTCACGTCCGGTGGTACTACCGGCCGGAGGAGTCAATCGGCGGCCGCCGCCAGTTTCATGGCTCCAAGGAGGTTTTCCTCTCCGATCACTTCGATGTTCAGAGCGCCGACACAATCGAAGCCAAGTGTACGGTCCACAGCTTCAAGAGCTACACGAAGCTCGATGCTGTCGGAAACGACGATTTCTTCTGTCGTTTTGAGTACAATTCCTCCACCGGCGCCTTCAATCCTGATAGAGTTGCTGTGTATTGTAAATGTGAGATGCCTTACAACCCTGATGACCTAATGGTCCAATGTGAGGGCTGCACTGACTGGTTCCATCCTGCATGTATAGACATGACTGTGGAAGAAGCCAAAAGACTTGACCACTTCTTTTGTGAAAATTGCTCTGCTGAAGGTCAAAAAAAGTTGCAAAACTCTCATTCTGCTTCTAGACACTCAGATACAAAGGTGGATACTAAACGCCGTCGTAGGTAA
Predicted protein sequences of Glyma04g01140
>Glyma04g01140.1   sequence type=predicted peptide   gene model=Glyma04g01140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAKPKAPRRTLESYSVKHISKTIRAGDCVLMRPSDLSKPSYVARIERIEADARGSNVKIHVRWYYRPEESIGGRRQFHGSKEVFLSDHFDVQSADTIEAKCTVHSFKSYTKLDAVGNDDFFCRFEYNSSTGAFNPDRVAVYCKCEMPYNPDDLMVQCEGCTDWFHPACIDMTVEEAKRLDHFFCENCSAEGQKKLQNSHSASRHSDTKVDTKRRRR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo