SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma04g00990

Feature Type:gene_model
Chromosome:Gm04
Start:573794
stop:574692
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G21290AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: mitochondrion; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; Has 63 Blast hits to 63 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 63; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr2:9112888-9113184 FORWARD LENGTH=98 SoyBaseE_val: 9.00E-23ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_B9RHE2UniRef Annotation by Michelle Graham. Most informative UniRef hit: 30S ribosomal protein S31, mitochondrial, putative n=1 Tax=Ricinus communis RepID=B9RHE2_RICCO SoyBaseE_val: 2.00E-31ISS
UniRef100_UPI000233A694UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A694 related cluster n=1 Tax=unknown RepID=UPI000233A694 SoyBaseE_val: 5.00E-43ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma06g01010 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g007900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g00990.2   sequence type=CDS   gene model=Glyma04g00990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCGTTAATGGTGCGAGCGTGATGCAGCGGTGCAGCGTGGCTGCGAGGTTGTTCATGACGGCGGAGAGGGCGGCTCCGGCGGTGCCTCAAGTGTGTGGACGCGGGGACCAGAAGACGAAGAAAGGGAAGAGGTTCAAGGGTTCGTACGGTAACGCTAGGCCGAAGAAAGAGAAGATGATAGAGCGCATCAAGGACAAGGTCGAAGTTCCCAGGTCCACTCCTTGGCCTCTCCCTTTCAAGCTCATCTGA

>Glyma04g00990.2   sequence type=predicted peptide   gene model=Glyma04g00990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVNGASVMQRCSVAARLFMTAERAAPAVPQVCGRGDQKTKKGKRFKGSYGNARPKKEKMIERIKDKVEVPRSTPWPLPFKLI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo