Glyma04g00840 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g00840

Feature Type:	gene_model
Chromosome:	Gm04
Start:	472775
stop:	473540
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g00840

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G18060	AT	Annotation by Michelle Graham. TAIR10: SAUR-like auxin-responsive protein family \| chr5:5976030-5976302 FORWARD LENGTH=90	SoyBase	E_val: 2.00E-32	ISS
GO:0009733	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF02519	PFAM	Auxin responsive protein	JGI		ISS
UniRef100_B9HRD6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: SAUR family protein n=1 Tax=Populus trichocarpa RepID=B9HRD6_POPTR	SoyBase	E_val: 1.00E-31	ISS
UniRef100_UPI000233A691	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233A691 related cluster n=1 Tax=unknown RepID=UPI000233A691	SoyBase	E_val: 3.00E-52	ISS

Expression Patterns of Glyma04g00840

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g00840 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g006500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g00840

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g00840

Limit To All Plant Sequences

>Glyma04g00840.2   sequence type=CDS   gene model=Glyma04g00840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTTTCAGTTTGCGTGGTCTTCAAAGGCGTGTGGATGTCCCAAAGGGCAGTGTAGCAGTGTATGTAGGAGAAAGCCAAAAGAAGCGCTTTGTGGTTCCCATATCATACTTGAACCAACCTTCATTTCTTGAGTTGCTGAGTCAAGCTGAGCAAGAATTTGGATTTGATCATCCAATGGGTGGCCTCACACTTCCTTACACAGAAGAAGTCTTCCTGGATGTCACTTCTCGCTTGCACAGGCGATAA

Predicted protein sequences of Glyma04g00840

Limit To All Plant Sequences

>Glyma04g00840.2   sequence type=predicted peptide   gene model=Glyma04g00840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGFSLRGLQRRVDVPKGSVAVYVGESQKKRFVVPISYLNQPSFLELLSQAEQEFGFDHPMGGLTLPYTEEVFLDVTSRLHRR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain