Glyma04g00741 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g00741

Feature Type:	gene_model
Chromosome:	Gm04
Start:	413710
stop:	415034
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g00741

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
UniRef100_B9STD3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9STD3_RICCO	SoyBase	E_val: 2.00E-07	ISS

Expression Patterns of Glyma04g00741

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g00741 not represented in the dataset	Glyma04g00741 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g00741

Paralog	Evidence	Comments
Glyma06g00760	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g00741 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g005600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g00741

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g00741

Limit To All Plant Sequences

>Glyma04g00741.1   sequence type=CDS   gene model=Glyma04g00741   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTTACTATTGCTATAAACGCAATTATAGTACTCATACATCAGATGTTATTGTGATGTTGGCGGTGGCCTTGATGCTTCTTGGCATACCTTGGCTCTTTACGCGTGAACAAGTGGTGGTAGTTGAAGAAAAGAAGACGAATTGGTCAGCTTTGATCACACCAATACTAGTACTACTCATCTTGCTTTTGCTGTCACTGATTGGAACTCCCAGGAGGGTTTATGCAAAGCCAACGTGCTATCGGTGGAAGAAAAAGAAGAACAGGAGAAGAAAGGAAAACAGCATGGTTTCTTCATGA

Predicted protein sequences of Glyma04g00741

Limit To All Plant Sequences

>Glyma04g00741.1   sequence type=predicted peptide   gene model=Glyma04g00741   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGYYCYKRNYSTHTSDVIVMLAVALMLLGIPWLFTREQVVVVEEKKTNWSALITPILVLLILLLLSLIGTPRRVYAKPTCYRWKKKKNRRRKENSMVSS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain