Glyma04g00730 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g00730

Feature Type:	gene_model
Chromosome:	Gm04
Start:	409468
stop:	410194
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g00730

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G21180	AT	Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G19875.1); Has 124 Blast hits to 124 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 124; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). \| chr2:9074956-9075351 REVERSE LENGTH=131	SoyBase	E_val: 1.00E-20	ISS
GO:0006661	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphatidylinositol biosynthetic process	SoyBase	N/A	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005575	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cellular component	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_D7LEB2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Oxidoreductase/ transition metal ion binding protein n=2 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LEB2_ARALL	SoyBase	E_val: 2.00E-06	ISS
UniRef100_I1JSF8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1JSF8_SOYBN	SoyBase	E_val: 2.00E-80	ISS

Expression Patterns of Glyma04g00730

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g00730

Paralog	Evidence	Comments
Glyma06g00750	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g00730 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g005500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g00730

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g00730

Limit To All Plant Sequences

>Glyma04g00730.1   sequence type=CDS   gene model=Glyma04g00730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCTATGGTAGAAGCAGAGCATCCTCTGTTTTGGACGGTTTCAGTCTAAACCCCGTGCCATACCCCGTTCTGCTAATCTTATCACTGATCCTTCTATTCCTCGGCATTTCATGGTACTTGTCGTATGAAGAAGTAGTTGAAGCCGCTGAAGAACAACTGGGGTGGATGCTGTTAGCCACACCAGTGGTGCTAATACTCGTAGTTCGTTGGTTATCGTCAGTGGATACTTCAGAATGGTTCTTCTTTAACTCCTCGCCATGGGAGAGGCGTAGGAGAACCCACCACTTCCCATCAGAGGGTAGCTCCCCTTGGGGTGTTGCTGCTTTGATCCTGCTTGTTCTCGTGCTTCTTCATTATCACTCCACTTTTCTTGATGCCTGGTTTGTTTGA

Predicted protein sequences of Glyma04g00730

Limit To All Plant Sequences

>Glyma04g00730.1   sequence type=predicted peptide   gene model=Glyma04g00730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGYGRSRASSVLDGFSLNPVPYPVLLILSLILLFLGISWYLSYEEVVEAAEEQLGWMLLATPVVLILVVRWLSSVDTSEWFFFNSSPWERRRRTHHFPSEGSSPWGVAALILLVLVLLHYHSTFLDAWFV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain