Glyma04g00660 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g00660

Feature Type:	gene_model
Chromosome:	Gm04
Start:	379293
stop:	380779
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g00660

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G21060	AT	Annotation by Michelle Graham. TAIR10: glycine-rich protein 2B \| chr2:9036983-9037588 REVERSE LENGTH=201	SoyBase	E_val: 2.00E-38	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0009790	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development	SoyBase	N/A	ISS
GO:0010154	GO-bp	Annotation by Michelle Graham. GO Biological Process: fruit development	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
KOG3070	KOG	Predicted RNA-binding protein containing PIN domain and invovled in translation or RNA processing	JGI		ISS
PTHR11544	Panther	COLD SHOCK DOMAIN CONTAINING PROTEINS	JGI		ISS
PTHR11544:SF12	Panther	Y BOX BINDING PROTEIN	JGI		ISS
PF00098	PFAM	Zinc knuckle	JGI		ISS
PF00313	PFAM	Cold-shock' DNA-binding domain	JGI		ISS
UniRef100_I1JSF3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JSF3_SOYBN	SoyBase	E_val: 2.00E-119	ISS
UniRef100_Q38896	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cold shock domain-containing protein 4 n=1 Tax=Arabidopsis thaliana RepID=CSP4_ARATH	SoyBase	E_val: 9.00E-36	ISS

Expression Patterns of Glyma04g00660

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g00660 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g004900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g00660

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g00660

Limit To All Plant Sequences

>Glyma04g00660.1   sequence type=CDS   gene model=Glyma04g00660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTGAGAGTGAGAAGCAGAGGGTAACGGGGAAGGTGAAGTGGTTCGATGACCAGAAGGGTTTTGGCTTCATAACCACCGACGACAGCGGCGAGGAATTCTTCGTCCACCAGTCCTCCATCCGATCCGACGGCTTCCGCAGCCTCGCCCTCGGCGAGTCCGTCGAGTTCCTTATTGACTCCGATCCCGAAGGCCGCACCAAGGCCGTCGACGTCACCGGCCCTGACGAATCGCCAGTCCAGGGCACCCGCGGTGGCGGAGGAGGAGGAAGAGGAAGCTATGGTGGAGGTGGCGGAAGAGGTGGCTATGGTGGTGGCGGACGCGGCGGAAGAGGTGGATATGGAGGAGGCGGCGGAGGCTATGGGGGAGGTGGCTATGGCGGAGGCGGTGGTTATGGTGGAGGTGGCGGCGGCGGCGGAGGGGGATGCTATAAGTGTGGCGAGACTGGTCACATAGCTAGGGACTGCAGCCAAGGTGGGGGTGGCGGTGGAAGGTACGGCGGTGGTGGGGGTGGCGGCGGAAGCTGCTACAACTGTGGGGAGTCCGGGCATTTTGCCAGGGACTGCCCTTCCAGTGCTCGTTGA

Predicted protein sequences of Glyma04g00660

Limit To All Plant Sequences

>Glyma04g00660.1   sequence type=predicted peptide   gene model=Glyma04g00660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSESEKQRVTGKVKWFDDQKGFGFITTDDSGEEFFVHQSSIRSDGFRSLALGESVEFLIDSDPEGRTKAVDVTGPDESPVQGTRGGGGGGRGSYGGGGGRGGYGGGGRGGRGGYGGGGGGYGGGGYGGGGGYGGGGGGGGGGCYKCGETGHIARDCSQGGGGGGRYGGGGGGGGSCYNCGESGHFARDCPSSAR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain