Glyma04g00500 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g00500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g00500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g00500

Feature Type:	gene_model
Chromosome:	Gm04
Start:	269407
stop:	270245
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g00500

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G38580	AT	Annotation by Michelle Graham. TAIR10: farnesylated protein 6 \| chr4:18034596-18035693 FORWARD LENGTH=153	SoyBase	E_val: 8.00E-88	ISS
GO:0010286	GO-bp	Annotation by Michelle Graham. GO Biological Process: heat acclimation	SoyBase	N/A	ISS
GO:0030001	GO-bp	Annotation by Michelle Graham. GO Biological Process: metal ion transport	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0046872	GO-mf	Annotation by Michelle Graham. GO Molecular Function: metal ion binding	SoyBase	N/A	ISS
KOG1603	KOG	Copper chaperone	JGI		ISS
PTHR22814	Panther	COPPER TRANSPORT PROTEIN ATOX1-RELATED	JGI		ISS
PTHR22814:SF26	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00403	PFAM	Heavy-metal-associated domain	JGI		ISS
UniRef100_B9T850	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Metal ion binding protein, putative n=1 Tax=Ricinus communis RepID=B9T850_RICCO	SoyBase	E_val: 6.00E-93	ISS
UniRef100_I1JSE0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JSE0_SOYBN	SoyBase	E_val: 3.00E-109	ISS

Expression Patterns of Glyma04g00500

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g00500 not represented in the dataset	Glyma04g00500 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g00500 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g003700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g00500

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g00500

Limit To All Plant Sequences

>Glyma04g00500.1   sequence type=CDS   gene model=Glyma04g00500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGCTCTGGATCACATATCGGAACTCTTTGACTGCTCCAGTGGCAGTTCCAAGCACAAGAAGCGCAAGCAATTGCAGACGGTGGAGGTGAAAGTGAAGATGGACTGCGAAGGATGCGAGAGGAAAGTGAGGAAGGCGGTGGAGGGGATGAAAGGCGTGAACCAGGTGGATGTGGAGCGTAAGGCCAACAAAGTCACTGTGGTCGGCTACGTCGAGGCCTCTAAGGTGGTCGCCCGCATCGCTCACCGCACCGGCAAGAAAGCAGAGCTCTGGCCCTACGTCCCCTACGACGTCGTTGCTCACCCCTACGCACCCGGAGTCTACGACAAGAAAGCCCCCTCCGGTTATGTCCGCAACACCGATGATCCTCACTATTCCCATCTCGCACGTGCCAGCTCCACTGAGGTCCGCTACACCACTGCTTTCAGCGACGAAAACCCCTCCGCCTGTGTCGTTATGTGA

Predicted protein sequences of Glyma04g00500

Limit To All Plant Sequences

>Glyma04g00500.1   sequence type=predicted peptide   gene model=Glyma04g00500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGALDHISELFDCSSGSSKHKKRKQLQTVEVKVKMDCEGCERKVRKAVEGMKGVNQVDVERKANKVTVVGYVEASKVVARIAHRTGKKAELWPYVPYDVVAHPYAPGVYDKKAPSGYVRNTDDPHYSHLARASSTEVRYTTAFSDENPSACVVM*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain