SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g00470

Feature Type:gene_model
Chromosome:Gm04
Start:245518
stop:246244
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g00470
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G47140AT Annotation by Michelle Graham. TAIR10: NAD(P)-binding Rossmann-fold superfamily protein | chr2:19350970-19352059 REVERSE LENGTH=257 SoyBaseE_val: 1.00E-46ISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
KOG0725 KOG Reductases with broad range of substrate specificities JGI ISS
PTHR24314Panther FAMILY NOT NAMED JGI ISS
PTHR24314:SF85Panther JGI ISS
PF00106PFAM short chain dehydrogenase JGI ISS
UniRef100_G7KNP7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Short-chain alcohol dehydrogenase n=1 Tax=Medicago truncatula RepID=G7KNP7_MEDTR SoyBaseE_val: 2.00E-82ISS
UniRef100_I1JSD7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JSD7_SOYBN SoyBaseE_val: 7.00E-124ISS

Expression Patterns of Glyma04g00470
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g00470 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma04g00470
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g00470
>Glyma04g00470.2   sequence type=CDS   gene model=Glyma04g00470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGAATGTACATCCACTCCCACCAACAGCAGTCTCAGGTTAACAGCCAAAGTAGCCATTGTCACAGGAGGTGCCAGTGGCATCGGCGAAGCAACGGCGCGTGTCTTTGCGGAGCAAGGCGCGCGTATGGTGGTAATCGCAGACATCCAAGACGATCTGGTGAATCGAGTGGCAGCGTCCATTGGCACTCACAGGTGCACCTACGTTCACTGCGACGTGGCAGACGAAGAACAAGTCAAATACCTCGTTCAAACAACGGTCAATGCGTACGAAACGCTGGGATCGCTAGTCCCTCCAAACAGACAGTATCCGAACTCGACATGTCCCAACAACTGTTCGCGGTCAACATGCATACGTGGAATAGCGGCGTGCGTGAAACACGCAGCGCGTGCGATATTGGAGGGGCGCGTGAGGGGAAGCATTATTTGCACGGCGAGCGTGGTTGGCAGCCACGGTGAGCCAAATGCGACGAACTACATAATGTCGAAGCACGCGGTGTTGGGGTTGATGCGTTCGGCGAGCGTGCAGCTTGCGGAACACGGGATAAGAGTGAACTGCGTCTCGCCCAATGGGTTGGCAACGCCGTTGACTTGTAAAGTGCGAGGGATTAGGTGCAAGAGGTTTACCGGCAGTTCGCGAGACTGGAAGGAGTGGTTCTCACGCCCAAAGACGTGGCAGACACCGTGTTGTTGTCTCCGATGA
Predicted protein sequences of Glyma04g00470
>Glyma04g00470.2   sequence type=predicted peptide   gene model=Glyma04g00470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAECTSTPTNSSLRLTAKVAIVTGGASGIGEATARVFAEQGARMVVIADIQDDLVNRVAASIGTHRCTYVHCDVADEEQVKYLVQTTVNAYETLGSLVPPNRQYPNSTCPNNCSRSTCIRGIAACVKHAARAILEGRVRGSIICTASVVGSHGEPNATNYIMSKHAVLGLMRSASVQLAEHGIRVNCVSPNGLATPLTCKVRGIRCKRFTGSSRDWKEWFSRPKTWQTPCCCLR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo