Report for Sequence Feature Glyma04g00380
Feature Type: gene_model
Chromosome: Gm04
Start: 167259
stop: 169043
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g00380
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G38110 AT
Annotation by Michelle Graham. TAIR10: anti- silencing function 1b | chr5:15208643-15210064 FORWARD LENGTH=218
SoyBase E_val: 2.00E-102 ISS
GO:0000724 GO-bp
Annotation by Michelle Graham. GO Biological Process: double-strand break repair via homologous recombination
SoyBase N/A ISS
GO:0006139 GO-bp
Annotation by Michelle Graham. GO Biological Process: nucleobase-containing compound metabolic process
SoyBase N/A ISS
GO:0006261 GO-bp
Annotation by Michelle Graham. GO Biological Process: DNA-dependent DNA replication
SoyBase N/A ISS
GO:0006333 GO-bp
Annotation by Michelle Graham. GO Biological Process: chromatin assembly or disassembly
SoyBase N/A ISS
GO:0008361 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of cell size
SoyBase N/A ISS
GO:0009294 GO-bp
Annotation by Michelle Graham. GO Biological Process: DNA mediated transformation
SoyBase N/A ISS
GO:0010091 GO-bp
Annotation by Michelle Graham. GO Biological Process: trichome branching
SoyBase N/A ISS
GO:0031567 GO-bp
Annotation by Michelle Graham. GO Biological Process: cell size control checkpoint
SoyBase N/A ISS
GO:0051301 GO-bp
Annotation by Michelle Graham. GO Biological Process: cell division
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
GO:0005515 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein binding
SoyBase N/A ISS
KOG3265
KOG
Histone chaperone involved in gene silencing
JGI ISS
PTHR12040 Panther
ANTI-SILENCING PROTEIN 1
JGI ISS
PF04729 PFAM
ASF1 like histone chaperone
JGI ISS
UniRef100_G7J8L0 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Histone chaperone ASF1B n=1 Tax=Medicago truncatula RepID=G7J8L0_MEDTR
SoyBase E_val: 1.00E-118 ISS
UniRef100_I1JSC8 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JSC8_SOYBN
SoyBase E_val: 1.00E-134 ISS
Expression Patterns of Glyma04g00380
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma04g00380
Paralog Evidence Comments
Glyma06g00450 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma04g00380 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g002500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g00380
Coding sequences of Glyma04g00380
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g00380.1 sequence type=CDS gene model=Glyma04g00380 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAGTGCTGTGAACATCACCAACGTCACCGTCCTGGACAACCCTGCTTCCTTTCTGACTCCCTTTCAGTTCGAGATTTCCTACGAGTGTCTCACCGCTCTCAAAGATGATTTGGAATGGAAGCTCATTTATGTTGGATCTGCTGAGGATGAGACCTATGATCAATTATTAGAGAGTGTCCTTGTTGGTCCTGTCAACGTTGGAAACTATCGCTTTGTTTTACAGGCAGATCCACCCGATCCATCAAAGATTCGTGAAGAAGATATAATTGGTGTCACTGTGCTTCTGTTGACCTGCTCCTATCTGGGTCAGGAATTTATTCGTGTTGGCTATTATGTGAACAATGATTATGATGATGAGCAGCTGAGAGAGGAACCTCCACCAAAGGTTTTAATTGATAGGGTTCAAAGGAACATTTTGTCTGATAAGCCAAGGGTTACAAAGTTTCCCATCAATTTCCACCCTGAGAACAATGAAAATGAAGAGCAACTCCCGCCATCCGAGCACCCATCGGAAACTGGAGAAGATCCACTTGCTGTAGTTGATCGTGATCCTCCAGATGAGAAGGATTCTTAA
Predicted protein sequences of Glyma04g00380
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g00380.1 sequence type=predicted peptide gene model=Glyma04g00380 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSAVNITNVTVLDNPASFLTPFQFEISYECLTALKDDLEWKLIYVGSAEDETYDQLLESVLVGPVNVGNYRFVLQADPPDPSKIREEDIIGVTVLLLTCSYLGQEFIRVGYYVNNDYDDEQLREEPPPKVLIDRVQRNILSDKPRVTKFPINFHPENNENEEQLPPSEHPSETGEDPLAVVDRDPPDEKDS*