SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g42280): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g42280): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g42280

Feature Type:gene_model
Chromosome:Gm03
Start:47519272
stop:47521234
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g42280
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G46860AT Annotation by Michelle Graham. TAIR10: pyrophosphorylase 3 | chr2:19253843-19255060 FORWARD LENGTH=216 SoyBaseE_val: 1.00E-135ISS
GO:0006796GO-bp Annotation by Michelle Graham. GO Biological Process: phosphate-containing compound metabolic process SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0000287GO-mf Annotation by Michelle Graham. GO Molecular Function: magnesium ion binding SoyBaseN/AISS
GO:0004427GO-mf Annotation by Michelle Graham. GO Molecular Function: inorganic diphosphatase activity SoyBaseN/AISS
GO:0016462GO-mf Annotation by Michelle Graham. GO Molecular Function: pyrophosphatase activity SoyBaseN/AISS
KOG1626 KOG Inorganic pyrophosphatase/Nucleosome remodeling factor, subunit NURF38 JGI ISS
PTHR10286Panther INORGANIC PYROPHOSPHATASE JGI ISS
PF00719PFAM Inorganic pyrophosphatase JGI ISS
UniRef100_Q2HTA8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Inorganic pyrophosphatase n=1 Tax=Medicago truncatula RepID=Q2HTA8_MEDTR SoyBaseE_val: 1.00E-137ISS
UniRef100_UPI00023379C7UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023379C7 related cluster n=1 Tax=unknown RepID=UPI00023379C7 SoyBaseE_val: 7.00E-154ISS

Expression Patterns of Glyma03g42280
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g42280 not represented in the dataset
Glyma03g42280 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g42280
ParalogEvidenceComments
Glyma19g45050 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g42280 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g262000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g42280
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g42280
>Glyma03g42280.1   sequence type=CDS   gene model=Glyma03g42280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTGAGAATGGTGAAGAGGCAGGAGAAAATCGTCCAGTTCCCCGTTTGAACGAAAGAATTCTTTCATCTTTGTCAAAAAGATCAGTAGCTGCCCATCCTTGGCATGATCTTGAAATTGGACCTGAGGCTCCTCAAATTTTCAATTGTGTTGTGGAGATCACTAAAGGAAGCAAGGTCAAATATGAACTTGACAAGAAGACAGGATTGATTAAGGTTGATCGGGTTTTGTATTCATCAGTTGTTTATCCTCATAACTATGGTTTTATCCCTCGCACACTGTGTGAAGACAATGATCCAATTGATGTTTTGGTTCTCATGCAGGAGCCTGTTCTTCCTGGATGTTTTCTGCGAGCCCGGGCCATTGGACTTATGCCCATGATTGACGGGGGAGAGAAAGATGATAAAATCATTGCAGTGTGTGCTGATGACCCAGAATATAAACACTTTACAGACTATAGAGAACTTGCACCTCATCGCATCTCTGAGATCCGACGCTTCTTTGAAGACTACAAAAAGAATGAGCACAAGGAGGTAGCAGTTAATGATTTTCTACCTGCAAGCGTTGCTCTTGATGCCATCCAGTACTCAATGGATCTCTACGCAGAGTATATTCTGCACACCCTGAGGCGATAG
Predicted protein sequences of Glyma03g42280
>Glyma03g42280.1   sequence type=predicted peptide   gene model=Glyma03g42280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSENGEEAGENRPVPRLNERILSSLSKRSVAAHPWHDLEIGPEAPQIFNCVVEITKGSKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPIDVLVLMQEPVLPGCFLRARAIGLMPMIDGGEKDDKIIAVCADDPEYKHFTDYRELAPHRISEIRRFFEDYKKNEHKEVAVNDFLPASVALDAIQYSMDLYAEYILHTLRR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo