SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g42230): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g42230): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g42230

Feature Type:gene_model
Chromosome:Gm03
Start:47489789
stop:47491013
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G01410AT Annotation by Michelle Graham. TAIR10: Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family | chr4:578308-578991 FORWARD LENGTH=227 SoyBaseE_val: 1.00E-71ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF03168PFAM Late embryogenesis abundant protein JGI ISS
UniRef100_I1JS44UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JS44_SOYBN SoyBaseE_val: 4.00E-140ISS
UniRef100_Q2HTB8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Harpin-induced 1 n=1 Tax=Medicago truncatula RepID=Q2HTB8_MEDTR SoyBaseE_val: 2.00E-99ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g42230 not represented in the dataset

Glyma03g42230 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma19g44980 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g261400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g42230.1   sequence type=CDS   gene model=Glyma03g42230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAAAGGACAAAGTTTCCGGTGATCCAAGACGCGCAGTGTGCACAGGCATCACCATCTTCCTCCTCTTAGCCGGCGTCACTCTCCTAGTCCTCTGGCTGGTCTACCGTCCCCACAAGCCGCGCTTCACAGTAATCGGCGCCGCCGTCTACGACCTAAACACCACCACCCCACCGCTGATGTCGACCACCGTGCAGTTCTCCGTCCTCATAAAGAACCCGAACAGGCGTGTCTCCATTTACTACGACAGGTTCTCCGCCTTTGTCTCGTACAGGAACCAGGCCATAACGCCGCAGGTTCTGCTGCCGCCTCTGCACCAGGAGAAGCGAAGCTCGGTGTCGGTGTCGCCGGTGATGGGAGGCACGGCGCTTCCGGTGTCGGTGGAGGTGTCTGACGGGCTGGCGGTGGACGAGGCTTATGGGTTGGTGGGTCTGAGGCTGATATTTGAGGGCAGAGTGAGGTGGAAGGCCGGGGCCATCAAAACTGCGCACTATGGACTGTACGTTAAGTGCGATGTTTTGATGGGTTTGAAGAAAGGGTTGGTGGGTCAAGTTCCTCTCCTGGGAGTTACACCCTGCCATGTCCATCTATGA

>Glyma03g42230.1   sequence type=predicted peptide   gene model=Glyma03g42230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSKDKVSGDPRRAVCTGITIFLLLAGVTLLVLWLVYRPHKPRFTVIGAAVYDLNTTTPPLMSTTVQFSVLIKNPNRRVSIYYDRFSAFVSYRNQAITPQVLLPPLHQEKRSSVSVSPVMGGTALPVSVEVSDGLAVDEAYGLVGLRLIFEGRVRWKAGAIKTAHYGLYVKCDVLMGLKKGLVGQVPLLGVTPCHVHL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo