SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g42050

Feature Type:gene_model
Chromosome:Gm03
Start:47365114
stop:47366990
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g42050
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G61870AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast, chloroplast inner membrane, chloroplast envelope; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 14 growth stages; Has 200 Blast hits to 200 proteins in 73 species: Archae - 0; Bacteria - 112; Metazoa - 0; Fungi - 0; Plants - 53; Viruses - 0; Other Eukaryotes - 35 (source: NCBI BLink). | chr3:22902702-22903895 FORWARD LENGTH=272 SoyBaseE_val: 2.00E-87ISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009657GO-bp Annotation by Michelle Graham. GO Biological Process: plastid organization SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009706GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast inner membrane SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1JS20UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JS20_SOYBN SoyBaseE_val: 6.00E-175ISS
UniRef100_Q9M277UniRef Annotation by Michelle Graham. Most informative UniRef hit: AT3g61870/F21F14_40 n=1 Tax=Arabidopsis thaliana RepID=Q9M277_ARATH SoyBaseE_val: 8.00E-85ISS

Expression Patterns of Glyma03g42050
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g42050
ParalogEvidenceComments
Glyma19g44760 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g42050 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g259400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g42050
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g42050
>Glyma03g42050.1   sequence type=CDS   gene model=Glyma03g42050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCGCCACACTCACTCTTCTAAAGCTTCCAATCCTTCCTAACAAGCCATTACTGCCACGCCCATCAACCTCAAAACTTTTTCCACTTCCTTCCATCTATTCAAAATTAAATATCCCAAAAGATTATATTGTTTCTCCTAACAACATCGATGCTCTCAAGCCTGCCTTTCTTTCCCTCTCGGCAATCACATTTCCATTGTTATTAGAAACCAAGGATGCACTTGCTGTTGGTGGAGAGTTTGGGATATTGGAAGGAAGATCATTTGCTCTCATACACCCCATTGTGATGGGTTCTTTTTTCTTGTATACACTGTGGGCAGGGTACTTGGGGTGGCAATGGCGGCGAGTTAGGACTATCCAGAATGATATTAATGACCTCAAGAAACAAGTCAAACCTACCCCAGTCACCCCAGATGGGAAACCAGTGGAAGAAGCATCACCATCACCGGTTGAACTCCAAATACAGCAACTCACAGAGGAAAGGAAAGAGCTGATCAAAGGTTCCTATAAGGATAGACACTTCAATGCAGGATCCATACTTCTAGGATTTGGGGTGCTTGAGTCAATTGGTGGAGGAGTCAACACATGGTTTAGGACAGGAAAGCTTTTTCCCGGTCCACATTTATTTGCAGGAGCAGCTATTACCGTTTTATGGGAGAGTGGAATGATGATGACCCATCAATGCAAAAAGGAAATGAAACAGCCAGAAATCTTCACATCGCGCTGA
Predicted protein sequences of Glyma03g42050
>Glyma03g42050.1   sequence type=predicted peptide   gene model=Glyma03g42050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAATLTLLKLPILPNKPLLPRPSTSKLFPLPSIYSKLNIPKDYIVSPNNIDALKPAFLSLSAITFPLLLETKDALAVGGEFGILEGRSFALIHPIVMGSFFLYTLWAGYLGWQWRRVRTIQNDINDLKKQVKPTPVTPDGKPVEEASPSPVELQIQQLTEERKELIKGSYKDRHFNAGSILLGFGVLESIGGGVNTWFRTGKLFPGPHLFAGAAITVLWESGMMMTHQCKKEMKQPEIFTSR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo