Report for Sequence Feature Glyma03g41880
Feature Type: gene_model
Chromosome: Gm03
Start: 47235016
stop: 47236962
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma03g41880
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G01300 AT
Annotation by Michelle Graham. TAIR10: Eukaryotic aspartyl protease family protein | chr1:117065-118522 FORWARD LENGTH=485
SoyBase E_val: 0 ISS
GO:0006508 GO-bp
Annotation by Michelle Graham. GO Biological Process: proteolysis
SoyBase N/A ISS
GO:0009664 GO-bp
Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization
SoyBase N/A ISS
GO:0042545 GO-bp
Annotation by Michelle Graham. GO Biological Process: cell wall modification
SoyBase N/A ISS
GO:0080167 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to karrikin
SoyBase N/A ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0009505 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall
SoyBase N/A ISS
GO:0016020 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: membrane
SoyBase N/A ISS
GO:0004190 GO-mf
Annotation by Michelle Graham. GO Molecular Function: aspartic-type endopeptidase activity
SoyBase N/A ISS
KOG1339
KOG
Aspartyl protease
JGI ISS
PTHR13683 Panther
ASPARTYL PROTEASES
JGI ISS
PTHR13683:SF98 Panther
CHLOROPLAST NUCLEIOD DNA-BINDING-RELATED
JGI ISS
PF00026 PFAM
Eukaryotic aspartyl protease
JGI ISS
UniRef100_B9SBG8 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Aspartic proteinase nepenthesin-1, putative n=1 Tax=Ricinus communis RepID=B9SBG8_RICCO
SoyBase E_val: 0 ISS
UniRef100_I1JS04 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JS04_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma03g41880
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma03g41880
Paralog Evidence Comments
Glyma19g44540 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma03g41880 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.03g257900 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma03g41880
Coding sequences of Glyma03g41880
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma03g41880.1 sequence type=CDS gene model=Glyma03g41880 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAAGAAGGGAATTGGGTTCTCTTCCTAACCCTGGCCATCAGCCTCTGTGTCTCCGGCGCATTCCAAATCCAAACCGAAACCTTGCCCCTCCACACCCTCCCTGAGCCACACATCCTCTCAGAAACCCTCTCAGAACCCCAAGAAACTCTCTCGCTCTCACTTCACCTCCACCTCCACCACATAGACGCCCTCTCCTCCAACAAAACCCCAGAGCAGCTCTTCCACCTCAGGCTCCAACGCGACGCCAAGAGAGTCGAAGCCCTCCTCAACCAAATCCATGCGCGCAGATCCGCCGGCTCCAGTTTCAGCAGCTCCATCATTTCGGGCCTAGCACAAGGCAGCGGCGAGTACTTCACGCGCATAGGAGTTGGCACACCCGCCAGATACGTCTACATGGTTTTAGACACCGGAAGCGACGTCGTTTGGCTCCAATGCGCCCCTTGCCGCAAATGTTACACCCAAACCGACCACGTCTTTGACCCCACCAAGTCCCGAACCTACGCCGGAATCCCCTGTGGGGCCCCTCTCTGCCGCCGCTTAGACTCCCCCGGTTGCAGCAACAAAAACAAGGTTTGCCAATACCAGGTTTCCTACGGCGACGGCTCCTTCACATTCGGCGATTTCTCCACCGAAACGCTCACGTTTCGAAGAAACAGAGTCACGCGCGTCGCGCTTGGCTGTGGCCACGACAATGAAGGACTTTTCACAGGCGCTGCTGGCCTTTTGGGCCTGGGCCGTGGGAGGTTATCGTTTCCGGTCCAGACCGGACGCCGTTTCAACCACAAATTCTCCTACTGCCTCGTCGACCGTTCCGCTTCGGCCAAACCCTCCTCTGTCATCTTCGGAGATTCCGCTGTTTCCCGAACCGCGCACTTCACTCCTCTCATCAAAAACCCTAAGCTTGACACTTTCTACTACCTCGAGCTCCTCGGGATCAGTGTCGGCGGAGCGCCGGTGCGCGGCCTCTCCGCCTCGCTCTTCCGCCTTGACGCCGCGGGAAACGGCGGCGTCATCATCGACTCCGGCACCTCAGTGACCCGCCTCACCCGACCTGCCTACATTGCCCTCCGGGACGCGTTCCGCATCGGGGCCTCGCATCTGAAGCGCGCGCCGGAGTTCTCGCTCTTCGACACGTGTTTCGATCTGTCCGGGCTCACGGAGGTGAAGGTACCTACGGTGGTGTTGCATTTCCGAGGTGCTGACGTGTCCTTGCCGGCGACGAATTACTTGATTCCGGTGGACAACAGTGGGAGCTTCTGCTTCGCGTTTGCCGGAACTATGAGTGGTTTGTCCATAATTGGTAACATCCAGCAACAAGGTTTCCGGATCTCGTATGATCTGACGGGTTCGCGGGTCGGGTTTGCACCGAGAGGTTGCGTTTGA
Predicted protein sequences of Glyma03g41880
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma03g41880.1 sequence type=predicted peptide gene model=Glyma03g41880 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MEEGNWVLFLTLAISLCVSGAFQIQTETLPLHTLPEPHILSETLSEPQETLSLSLHLHLHHIDALSSNKTPEQLFHLRLQRDAKRVEALLNQIHARRSAGSSFSSSIISGLAQGSGEYFTRIGVGTPARYVYMVLDTGSDVVWLQCAPCRKCYTQTDHVFDPTKSRTYAGIPCGAPLCRRLDSPGCSNKNKVCQYQVSYGDGSFTFGDFSTETLTFRRNRVTRVALGCGHDNEGLFTGAAGLLGLGRGRLSFPVQTGRRFNHKFSYCLVDRSASAKPSSVIFGDSAVSRTAHFTPLIKNPKLDTFYYLELLGISVGGAPVRGLSASLFRLDAAGNGGVIIDSGTSVTRLTRPAYIALRDAFRIGASHLKRAPEFSLFDTCFDLSGLTEVKVPTVVLHFRGADVSLPATNYLIPVDNSGSFCFAFAGTMSGLSIIGNIQQQGFRISYDLTGSRVGFAPRGCV*