SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g41497): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g41497): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g41497

Feature Type:gene_model
Chromosome:Gm03
Start:46942011
stop:46945261
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g41497
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G46230AT Annotation by Michelle Graham. TAIR10: PIN domain-like family protein | chr2:18984459-18985850 REVERSE LENGTH=196 SoyBaseE_val: 9.00E-98ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0051604GO-bp Annotation by Michelle Graham. GO Biological Process: protein maturation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG3165 KOG Predicted nucleic-acid-binding protein, contains PIN domain JGI ISS
PTHR12416Panther UNCHARACTERIZED JGI ISS
PF04900PFAM Fcf1 JGI ISS
UniRef100_G7KNI1UniRef Annotation by Michelle Graham. Most informative UniRef hit: rRNA-processing protein FCF1-like protein n=2 Tax=Medicago truncatula RepID=G7KNI1_MEDTR SoyBaseE_val: 2.00E-105ISS
UniRef100_I1LU28UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LU28_SOYBN SoyBaseE_val: 3.00E-113ISS

Expression Patterns of Glyma03g41497
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g41497 not represented in the dataset
Glyma03g41497 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g41497
ParalogEvidenceComments
Glyma19g44101 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g41497 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g254200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g41497
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g41497
>Glyma03g41497.1   sequence type=CDS   gene model=Glyma03g41497   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTAAAGCTAAAAAAGGACCCAAATTTGCGGTTATGAAGAAGGCTGTCACTTCCAAAGCAATCAAAAATTCTCCATTATGCTTTGGTTTTGCTCTATTTCCATTCCCTGAATTCCAAGTCATTCATCGGCACTTTTTTTTTCAATACAATACTGCATTGGGACCCCCTTACCGTATTTTGGTGGATACCAACTTCATCAATTTTTCCATCCAGAATAAATTGGATTTGGAGAAAGGAATGATGGACTGCTTATATGCAAAATGCACCCCTTGTATCACAGACTGTGTGATGGCAGAACTTGAGAAGTTAGGCCAAAAATATCGTGTAGCTCTAAGGATTGCAAAGGATCCTCGATTTGAGAGAATACTCTGTACTCATAAAGGGATGTATGCTGATGACTGTCTTGTTGAGAGAGTTACTCAGCATAAGTGCTACATTGTTGCAACATGTGATCGGGACTTGAAGAGGAGGATCCGGAAGATTCCTGGTGTGCCAATTATGTACATCACCAAACGCAAGTACTCAATTGAGCGATTGCCTGAAGCAACAATTGGTGGAGCACCAAGAATTTGA
Predicted protein sequences of Glyma03g41497
>Glyma03g41497.1   sequence type=predicted peptide   gene model=Glyma03g41497   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGKAKKGPKFAVMKKAVTSKAIKNSPLCFGFALFPFPEFQVIHRHFFFQYNTALGPPYRILVDTNFINFSIQNKLDLEKGMMDCLYAKCTPCITDCVMAELEKLGQKYRVALRIAKDPRFERILCTHKGMYADDCLVERVTQHKCYIVATCDRDLKRRIRKIPGVPIMYITKRKYSIERLPEATIGGAPRI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo