SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g41400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g41400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g41400

Feature Type:gene_model
Chromosome:Gm03
Start:46888678
stop:46893673
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G47580AT Annotation by Michelle Graham. TAIR10: spliceosomal protein U1A | chr2:19517229-19518686 FORWARD LENGTH=250 SoyBaseE_val: 3.00E-120ISS
GO:0000398GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA splicing, via spliceosome SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005685GO-cc Annotation by Michelle Graham. GO Cellular Compartment: U1 snRNP SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
KOG4206 KOG Spliceosomal protein snRNP-U1A/U2B JGI ISS
PTHR10501Panther SMALL NUCLEAR RIBONUCLEOPROTEIN U1A,U2B JGI ISS
PF00076PFAM RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) JGI ISS
UniRef100_B9SAT1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Small nuclear ribonucleoprotein U1a,U2b, putative n=1 Tax=Ricinus communis RepID=B9SAT1_RICCO SoyBaseE_val: 3.00E-129ISS
UniRef100_I1JRV0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JRV0_SOYBN SoyBaseE_val: 6.00E-177ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g41400 not represented in the dataset

Glyma03g41400 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma19g43990 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g253300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g41400.1   sequence type=CDS   gene model=Glyma03g41400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTGAAGTGAATGCGACCCCTGAAATTCCTCAAAGCAACACCATCTACATCAACAACCTCAACGAGAAAATTAAGATTGATGAGTTGAAGAAGTCTCTGAACGCTGTTTTCACTCAGTTCGGGAAGATACTTGAGGTGTTAGCTTTCAAAACCCTAAAGCACAAAGGTCAAGCTTGGGTGGTCTTTGAAGATGCCTCTTCTGCTTCCAACGCCCTAAGGCAAATGCAAGGTTTCCCCTTCTATGATAAGCCCATGAGAATACAGTATGCAAAGACCAAATCTGATATAATAGCAAAAGCAGATGGTACTTTCGTTCCTAGGGAAAAACGAAAGAGGCATGATGACAAAGCCAAAAAGCGGAAGGACCAACATGATGCTAATTTAGCTGGAATGGGCCTGAATCCAGCTTATGCTGGTGCTTATGGTGCAGCACCTGCTATAGCTTATCCAGGCGGTGCAAAATCTATGGTACCTGAGGCTCCTGCACCACCAAATAATATTCTCTTTATTCAGAATCTTCCCAATGACTCAACTCCCATGATGCTGCAAATGCTCTTTCTTCAATATCCTGGATTTAAGGAAGTTAGAATGGTTGAAACAAAGCCAGGGATTGCCTTTGTGGAATATGGAGATGAAATGCAATCCACAGTGGCTATGCAGACGCTGCAAGGTTTCAAGATAACCCCACAAAACCCCATGTTGATAACTTATGCCAAGAAATAG

>Glyma03g41400.1   sequence type=predicted peptide   gene model=Glyma03g41400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSEVNATPEIPQSNTIYINNLNEKIKIDELKKSLNAVFTQFGKILEVLAFKTLKHKGQAWVVFEDASSASNALRQMQGFPFYDKPMRIQYAKTKSDIIAKADGTFVPREKRKRHDDKAKKRKDQHDANLAGMGLNPAYAGAYGAAPAIAYPGGAKSMVPEAPAPPNNILFIQNLPNDSTPMMLQMLFLQYPGFKEVRMVETKPGIAFVEYGDEMQSTVAMQTLQGFKITPQNPMLITYAKK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo