|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G02380 | AT | Annotation by Michelle Graham. TAIR10: senescence-associated gene 21 | chr4:1046414-1046807 REVERSE LENGTH=97 | SoyBase | E_val: 2.00E-18 | ISS |
| GO:0000165 | GO-bp | Annotation by Michelle Graham. GO Biological Process: MAPK cascade | SoyBase | N/A | ISS |
| GO:0000302 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to reactive oxygen species | SoyBase | N/A | ISS |
| GO:0006612 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane | SoyBase | N/A | ISS |
| GO:0006979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to oxidative stress | SoyBase | N/A | ISS |
| GO:0007154 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell communication | SoyBase | N/A | ISS |
| GO:0009409 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cold | SoyBase | N/A | ISS |
| GO:0009611 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to wounding | SoyBase | N/A | ISS |
| GO:0009738 | GO-bp | Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0009790 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development | SoyBase | N/A | ISS |
| GO:0009862 | GO-bp | Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0009867 | GO-bp | Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0010363 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response | SoyBase | N/A | ISS |
| GO:0016036 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation | SoyBase | N/A | ISS |
| GO:0019375 | GO-bp | Annotation by Michelle Graham. GO Biological Process: galactolipid biosynthetic process | SoyBase | N/A | ISS |
| GO:0030968 | GO-bp | Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response | SoyBase | N/A | ISS |
| GO:0031348 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response | SoyBase | N/A | ISS |
| GO:0042631 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular response to water deprivation | SoyBase | N/A | ISS |
| GO:0043069 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death | SoyBase | N/A | ISS |
| GO:0050832 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to fungus | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| PF03242 | PFAM | Late embryogenesis abundant protein | JGI | ISS | |
| UniRef100_C6T691 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T691_SOYBN | SoyBase | E_val: 2.00E-58 | ISS |
| UniRef100_Q9SP01 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Indole-3-acetic acid induced protein ARG-2 homolog n=1 Tax=Glycine max RepID=Q9SP01_SOYBN | SoyBase | E_val: 7.00E-53 | ISS |
|
Glyma03g41390 not represented in the dataset |
Glyma03g41390 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.03g253200 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma03g41390.1 sequence type=CDS gene model=Glyma03g41390 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCTCGTTCTATCGCTAACGCCAAGACTTTCTCCGCTCTCGTGCTAGACGGATTCTCCAACACTCTCACCAGACGTGGCTACTCTCAAAGCGCAACAAGGGGAGGAGTTGCCTCCATAGCACCCAAATCAGGGGAAGACAAAGGTGTCTCATCATACAAGGTTTCCTGGGTGCCAGATCCCGTCACCGGTTACTACAAACCGGAAAACATCAAGGAGGTTGATGTTGCCGATTTGCGTGCTACCCTTCTCCGCAAAAAATTCAACAACTAA
>Glyma03g41390.1 sequence type=predicted peptide gene model=Glyma03g41390 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MARSIANAKTFSALVLDGFSNTLTRRGYSQSATRGGVASIAPKSGEDKGVSSYKVSWVPDPVTGYYKPENIKEVDVADLRATLLRKKFNN*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||