Report for Sequence Feature Glyma03g41110
Feature Type: gene_model
Chromosome: Gm03
Start: 46638218
stop: 46643969
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma03g41110
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G08640 AT
Annotation by Michelle Graham. TAIR10: Chloroplast J-like domain 1 | chr1:2748714-2751209 REVERSE LENGTH=294
SoyBase E_val: 5.00E-126 ISS
GO:0006631 GO-bp
Annotation by Michelle Graham. GO Biological Process: fatty acid metabolic process
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0009941 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope
SoyBase N/A ISS
GO:0031969 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast membrane
SoyBase N/A ISS
PF11833 PFAM
Protein of unknown function (DUF3353)
JGI ISS
UniRef100_I1JRS4 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JRS4_SOYBN
SoyBase E_val: 0 ISS
UniRef100_Q93WG3 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Chloroplast J-like domain 1-containing protein n=1 Tax=Arabidopsis thaliana RepID=Q93WG3_ARATH
SoyBase E_val: 2.00E-123 ISS
Expression Patterns of Glyma03g41110
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma03g41110
Paralog Evidence Comments
Glyma19g43750 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma03g41110 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.03g250700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma03g41110
Coding sequences of Glyma03g41110
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma03g41110.1 sequence type=CDS gene model=Glyma03g41110 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTCTGGGAATCTCTAACATACTGCACTGCCCCAAATTGAGTTTCTCCCACAATAATTTTCTCCCCAAAGTTCCAACCTCTATCAGCCTCAGGTTTCCCCAGACAGCAGCATGGAGTGATAGAAAGATTATCTGTGCTGCTGCATCTGCGGCAGGAAGCTCTAATCCCGATGGTGAATTTAATCCTTATGAGGTGCTAGGTGTAAGCCCTATTGAGAAATTTGACATGGTCAAGGCAGCATATGCTAAAAAAAAGAAGGAGGCTGAGATGAATGGCGATGAAGCAACTGCTTCAAGACTGGAAAAGGCATATGACAAACTCATGATGGCTCAATTGTCTAATCGGAAAAAGGGTGTGACTTTTGGATCATTTAAGGTTTCAAAGGAGATCAAGTATGCTGACAAGCTTCCAGTTATACCTTGGGGGCCAAGGCTTACTAAATCAAGTCAAAATGACATGCGCATCAACTTGGCAATATCTGCTGTTTTTACAGCTTGGATCCTTGTCAAGCGCAGTGCTGAATATAAACCTTTGCAGTTTTTAGCCTTTGCCTTTGTTTATAGGCTTTTTGAGAAGTTAAAAGCCTCTGAATCTCCTGTAACCCCCAAATATAATGAAGAGGGTGAAGACACAGGAGAAGGACTCCGCATGGGAAAACGACTGCTCCGATCACTAGCCTTGGTTTTTGGATGTGTAGCTATTTCATCTTTGGCATACACTTTCATTTTGAACATAATTGAGTTTGCAGGTGGTTTTATTCCTACTCTTTTGTACAACAGTCAGGAGTTGATAATCACCACTTCATCGGCACTCATGCTTTATATCATGGCATCTTATTATAGATAG
Predicted protein sequences of Glyma03g41110
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma03g41110.1 sequence type=predicted peptide gene model=Glyma03g41110 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MALGISNILHCPKLSFSHNNFLPKVPTSISLRFPQTAAWSDRKIICAAASAAGSSNPDGEFNPYEVLGVSPIEKFDMVKAAYAKKKKEAEMNGDEATASRLEKAYDKLMMAQLSNRKKGVTFGSFKVSKEIKYADKLPVIPWGPRLTKSSQNDMRINLAISAVFTAWILVKRSAEYKPLQFLAFAFVYRLFEKLKASESPVTPKYNEEGEDTGEGLRMGKRLLRSLALVFGCVAISSLAYTFILNIIEFAGGFIPTLLYNSQELIITTSSALMLYIMASYYR*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
