SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g40770

Feature Type:gene_model
Chromosome:Gm03
Start:46429799
stop:46431096
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g40770
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G04720AT Annotation by Michelle Graham. TAIR10: pathogenesis-related 4 | chr3:1285691-1286531 REVERSE LENGTH=212 SoyBaseE_val: 7.00E-67ISS
GO:0009615GO-bp Annotation by Michelle Graham. GO Biological Process: response to virus SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009817GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus, incompatible interaction SoyBaseN/AISS
GO:0010167GO-bp Annotation by Michelle Graham. GO Biological Process: response to nitrate SoyBaseN/AISS
GO:0015706GO-bp Annotation by Michelle Graham. GO Biological Process: nitrate transport SoyBaseN/AISS
GO:0016998GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall macromolecule catabolic process SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0080027GO-bp Annotation by Michelle Graham. GO Biological Process: response to herbivore SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0004540GO-mf Annotation by Michelle Graham. GO Molecular Function: ribonuclease activity SoyBaseN/AISS
GO:0008061GO-mf Annotation by Michelle Graham. GO Molecular Function: chitin binding SoyBaseN/AISS
PTHR22595Panther CHITINASE-RELATED JGI ISS
PTHR22595:SF1Panther WOUND-INDUCED PROTEIN WIN-RELATED JGI ISS
PF00967PFAM Barwin family JGI ISS
UniRef100_C6T2R0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T2R0_SOYBN SoyBaseE_val: 8.00E-101ISS
UniRef100_I3VP71UniRef Annotation by Michelle Graham. Most informative UniRef hit: PR-4 protein n=1 Tax=Chimonanthus praecox RepID=I3VP71_9MAGN SoyBaseE_val: 4.00E-66ISS

Expression Patterns of Glyma03g40770
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g40770
ParalogEvidenceComments
Glyma19g43460 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g40770 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g247500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g40770
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g40770
>Glyma03g40770.1   sequence type=CDS   gene model=Glyma03g40770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAAAGGTATCTCTGTTTGTGGTGTGTGTCGTTTGCATTCTGGCATTGGCCTCTGCTCAGAGTGCTACAAATGTGAGAGCTACTTATCATTTGTACCAACCTGAGCAGCATAACTGGGACTTACTCGCAGTCAGTGCATATTGTTCAACTTGGGATGCTGACAAATCCTTGGCATGGCGCAGCAAATACGGTTGGACAGCTTTCTGTGGACCCTCTGGGCCTCAGGGCCAACAATCTTGTGGCAGGTGCTTGAGGGTGACAAACACTAGAACAAACGCTCAGGAAACGGTGAGAATTGTTGATCAGTGCAGCAACGGGGGCTTGGACTTGGATATTGGTCCGTTCCAAAAGCTGGACACTGACGGGAATGGCATTGCTCAAGGCCATCTTATTGTTAACTACGACTTCGTCGACTGCGGTGACTAA
Predicted protein sequences of Glyma03g40770
>Glyma03g40770.1   sequence type=predicted peptide   gene model=Glyma03g40770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAKVSLFVVCVVCILALASAQSATNVRATYHLYQPEQHNWDLLAVSAYCSTWDADKSLAWRSKYGWTAFCGPSGPQGQQSCGRCLRVTNTRTNAQETVRIVDQCSNGGLDLDIGPFQKLDTDGNGIAQGHLIVNYDFVDCGD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo