Glyma03g40760 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g40760

Feature Type:	gene_model
Chromosome:	Gm03
Start:	46424006
stop:	46426742
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g40760

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G04730	AT	Annotation by Michelle Graham. TAIR10: indoleacetic acid-induced protein 16 \| chr3:1288993-1290415 REVERSE LENGTH=236	SoyBase	E_val: 1.00E-100	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0006970	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to osmotic stress	SoyBase	N/A	ISS
GO:0009733	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus	SoyBase	N/A	ISS
GO:0010583	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0046983	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity	SoyBase	N/A	ISS
PF02309	PFAM	AUX/IAA family	JGI		ISS
UniRef100_B9SZ69	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Auxin-responsive protein IAA16, putative n=1 Tax=Ricinus communis RepID=B9SZ69_RICCO	SoyBase	E_val: 4.00E-115	ISS
UniRef100_I1JRN2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JRN2_SOYBN	SoyBase	E_val: 6.00E-178	ISS

Expression Patterns of Glyma03g40760

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g40760

Paralog	Evidence	Comments
Glyma19g43450	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g40760 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g247400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g40760

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g40760

Limit To All Plant Sequences

>Glyma03g40760.1   sequence type=CDS   gene model=Glyma03g40760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGCAGAGCGAGACAAGTACAAGATGATCAACTTTGAAGAAACCGAGTTACGACTCGGCCTCCCACTCAGTGGAAACGAGACGCTCAAAACCACTTGCAGCACTGGGAAGAGGGTTTTTTCGGATACTGCCGTGGATTTGAAGCTTAACCTTTCCTCAACCTCAAACAGTGCTTCTTCTGACCTGACTAAAGAGAAGAACATCACTGCTGCTGCACCTCCTGCTAACGACCCAGCAAAGCCACCTGCAAAGGCACAAGTGGTGGGGTGGCCACCAGTGAGGTCTTTCAGAAAGAACATTGTTCAAAGGAGTAACAACAATGAGGGCGAAAAAGCCGCCACAAGTAGTAGCAACAATGTGAACACGGGAGCAGCTTTCGTGAAGGTGAGCATGGATGGTGCTCCTTATTTACGCAAGGTGGATTTGAAGTTGTACAAGAGCTACCAAGAGTTGTTGGATGCGCTGGCTAAAATGTTCAGTTCATTCACCATTGACAAGTGTGGATCCCAAGGCATGAAAGACTTCATGAACGAGAGCAAATTGATTGATCTTCTCAACGGCTCTGATTACGTACCAACCTATGAAGACAAAGATGCTGACTGGATGCTCGTTGGTGACGTACCGTGGGAAATGTTCGTGGAATCATGCAAGCGCCTGCGTATAATGAAAGGATCTGAGGCAATCGGGCTAGCACCAAGAGCAGTGGAAAAGTGCAAGAACAGAAGCTAG

Predicted protein sequences of Glyma03g40760

Limit To All Plant Sequences

>Glyma03g40760.1   sequence type=predicted peptide   gene model=Glyma03g40760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEAERDKYKMINFEETELRLGLPLSGNETLKTTCSTGKRVFSDTAVDLKLNLSSTSNSASSDLTKEKNITAAAPPANDPAKPPAKAQVVGWPPVRSFRKNIVQRSNNNEGEKAATSSSNNVNTGAAFVKVSMDGAPYLRKVDLKLYKSYQELLDALAKMFSSFTIDKCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDADWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNRS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain