SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g40530): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g40530): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g40530

Feature Type:gene_model
Chromosome:Gm03
Start:46256329
stop:46258371
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G28060AT Annotation by Michelle Graham. TAIR10: Ribosomal protein S24e family protein | chr5:10069791-10070792 REVERSE LENGTH=133 SoyBaseE_val: 1.00E-82ISS
GO:0000462GO-bp Annotation by Michelle Graham. GO Biological Process: maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0006414GO-bp Annotation by Michelle Graham. GO Biological Process: translational elongation SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0022627GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG3424 KOG 40S ribosomal protein S24 JGI ISS
PTHR10496Panther 40S RIBOSOMAL PROTEIN S24 JGI ISS
PF01282PFAM Ribosomal protein S24e JGI ISS
UniRef100_C6SXD3UniRef Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S24 n=1 Tax=Glycine max RepID=C6SXD3_SOYBN SoyBaseE_val: 1.00E-92ISS
UniRef100_C6SXD3UniRef Annotation by Michelle Graham. Best UniRef hit: 40S ribosomal protein S24 n=1 Tax=Glycine max RepID=C6SXD3_SOYBN SoyBaseE_val: 1.00E-92ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g40530 not represented in the dataset

Glyma03g40530 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma19g43190 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g245300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g40530.1   sequence type=CDS   gene model=Glyma03g40530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGACAAGGCTGTTACAATCCGAACCCGAAAGTTCATGACCAACAGGCTTCTTTCCAGGAAGCAGTTTGTCGTTGATGTTCTTCATCCAGGGAGGGCAAATGTTTCCAAGGCTGAACTTAAGGAGAAGCTAGCTAGGATGTATGATGTGAAAGACCCTAATACTGTATTTGTCTTCAAATTCCGAACACATTTTGGAGGTGGCAAATCCACTGGATTTGGTTTGATTTATGACACAATGGAAAATGCTAAAAAGTATGAGCCCAAATACAGGCTTATCAGGAACGGCCTTGACACTAAGGTAGAAAAGTCAAGGAAGCAAATGAAGGAGAGAAAGAATAGAGCTAAGAAGATTCGCGGAGTAAAGAAGACCAAGGCTTCCGATGCTGCCAAGGCTGGAAAAAAGAAATAA

>Glyma03g40530.1   sequence type=predicted peptide   gene model=Glyma03g40530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MADKAVTIRTRKFMTNRLLSRKQFVVDVLHPGRANVSKAELKEKLARMYDVKDPNTVFVFKFRTHFGGGKSTGFGLIYDTMENAKKYEPKYRLIRNGLDTKVEKSRKQMKERKNRAKKIRGVKKTKASDAAKAGKKK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo