SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g40510): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g40510): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g40510

Feature Type:gene_model
Chromosome:Gm03
Start:46247594
stop:46248762
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g40510
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G54500AT Annotation by Michelle Graham. TAIR10: Rubredoxin-like superfamily protein | chr1:20357084-20357671 REVERSE LENGTH=195 SoyBaseE_val: 3.00E-58ISS
GO:0009773GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0030154GO-bp Annotation by Michelle Graham. GO Biological Process: cell differentiation SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0046872GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion binding SoyBaseN/AISS
PF00301PFAM Rubredoxin JGI ISS
UniRef100_C6T047UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T047_SOYBN SoyBaseE_val: 1.00E-142ISS
UniRef100_G7L0U0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Rubredoxin n=1 Tax=Medicago truncatula RepID=G7L0U0_MEDTR SoyBaseE_val: 3.00E-78ISS

Expression Patterns of Glyma03g40510
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g40510 not represented in the dataset
Glyma03g40510 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g40510
ParalogEvidenceComments
Glyma19g43170 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g40510 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g245100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g40510
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g40510
>Glyma03g40510.1   sequence type=CDS   gene model=Glyma03g40510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCATATACTATGGTTGTCCTTCTTCTCCTCCACACACCGTGAGGGCTGGCTGGTCAGAAATGAGAATGGCTTCAGCATTGTCCCTGCATCTCTCAACCCCTTTCTCCCAACTCCACCCTAGTCTCAAACCTAAAAAACTCCATGATTTCCCCACTCTCTCCCTCTCCAAACCTCGAAAACTCAGCGTGAACTCCGTGGACATCTCCAAAGAAGACACGCCCGTGAAACCCGAATCGGAGCTGGAGAACTTGGGGCCGCGGCGGCTGGAGGAGAAGTTCGCGGTTCTGAACACTGGAATCTACGAGTGCCGCTCCTGCGGCTATAAATACGACGAGGCAGTGGGCGACCCTTCCTATCCCTTACCGCCCGGCTATCAGTTCGAGAAGCTTCCGGATGATTGGCGCTGCCCCACTTGTGGGGCCGCCCAGAGTTTCTTCCAGAGCAAGAGCGTTCAGATCGCTGGGTTTGCTCAGAACCAGCAATATGGGCTTGGTGGCAATTCTCTCACTTCGGGTCAGAAGACTATTCTTATATACGGCACTTTGTTGCTCTTCTTTGCGCTCTTTTTGAGTGGCTACTTCCTCCAATAG
Predicted protein sequences of Glyma03g40510
>Glyma03g40510.1   sequence type=predicted peptide   gene model=Glyma03g40510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGIYYGCPSSPPHTVRAGWSEMRMASALSLHLSTPFSQLHPSLKPKKLHDFPTLSLSKPRKLSVNSVDISKEDTPVKPESELENLGPRRLEEKFAVLNTGIYECRSCGYKYDEAVGDPSYPLPPGYQFEKLPDDWRCPTCGAAQSFFQSKSVQIAGFAQNQQYGLGGNSLTSGQKTILIYGTLLLFFALFLSGYFLQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo