SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g39930

Feature Type:gene_model
Chromosome:Gm03
Start:45835336
stop:45839171
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g39930
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G27430AT Annotation by Michelle Graham. TAIR10: Signal peptidase subunit | chr5:9687470-9689185 FORWARD LENGTH=167 SoyBaseE_val: 4.00E-104ISS
GO:0006465GO-bp Annotation by Michelle Graham. GO Biological Process: signal peptide processing SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005787GO-cc Annotation by Michelle Graham. GO Cellular Compartment: signal peptidase complex SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0008233GO-mf Annotation by Michelle Graham. GO Molecular Function: peptidase activity SoyBaseN/AISS
KOG3372 KOG Signal peptidase complex subunit JGI ISS
PTHR12804Panther MICROSOMAL SIGNAL PEPTIDASE 23 KD SUBUNIT (SPC22/23) JGI ISS
PF04573PFAM Signal peptidase subunit JGI ISS
UniRef100_B9RF33UniRef Annotation by Michelle Graham. Most informative UniRef hit: Microsomal signal peptidase 23 kD subunit, putative n=1 Tax=Ricinus communis RepID=B9RF33_RICCO SoyBaseE_val: 7.00E-110ISS
UniRef100_I1JRE6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JRE6_SOYBN SoyBaseE_val: 4.00E-122ISS

Expression Patterns of Glyma03g39930
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g39930
ParalogEvidenceComments
Glyma19g42480 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g39930 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g239600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g39930
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g39930
>Glyma03g39930.1   sequence type=CDS   gene model=Glyma03g39930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCATTCATTCGGCTACAGAGCCAATGCGTTGCTAACCTTTGCCGTCACCATTTTGGCTCTTATGTGCGCCATGGCCTCTGTATCCGACAACTTCAACACCCCCACTCCCTCTGCACAAGTCCAGGTGTTGAACATCAACTGGTTTCAGAAACAGCCCAATGGCAATGACGAGGTCAGCATGACACTGAATATATCTGCAGATTTGCAGTCCCTTTTCACATGGAACACAAAACAGGTTTTTGTTTTTCTAGCTGCTGAGTATGAAACTCCTAAGAATTCCTTGAATCAGATATCCCTGTGGGATGGTATCATTCCCTCTAAAGAGCATGCGAAGTTTTGGATTCATACATCAAATAAATACCGCTTCATTGACCAGGGGAGCAATTTGCAGGGCAAAGAGTATAACCTGACTATGCATTGGCATGTTATGCCAAAGAGTGGCAAAATGTTTGCTGATAAAATAGTCATGCCAGGTTACCGATTGCCTGAGGAATATAGATGA
Predicted protein sequences of Glyma03g39930
>Glyma03g39930.1   sequence type=predicted peptide   gene model=Glyma03g39930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHSFGYRANALLTFAVTILALMCAMASVSDNFNTPTPSAQVQVLNINWFQKQPNGNDEVSMTLNISADLQSLFTWNTKQVFVFLAAEYETPKNSLNQISLWDGIIPSKEHAKFWIHTSNKYRFIDQGSNLQGKEYNLTMHWHVMPKSGKMFADKIVMPGYRLPEEYR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo