Report for Sequence Feature Glyma03g39860
Feature Type: gene_model
Chromosome: Gm03
Start: 45799618
stop: 45801932
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma03g39860
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G54860 AT
Annotation by Michelle Graham. TAIR10: Glycoprotein membrane precursor GPI-anchored | chr1:20457522-20458434 REVERSE LENGTH=200
SoyBase E_val: 2.00E-44 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0016114 GO-bp
Annotation by Michelle Graham. GO Biological Process: terpenoid biosynthetic process
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0031225 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_C6SYM8 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SYM8_SOYBN
SoyBase E_val: 3.00E-144 ISS
UniRef100_Q2HTL7 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: GPI-anchored protein, putative n=1 Tax=Medicago truncatula RepID=Q2HTL7_MEDTR
SoyBase E_val: 3.00E-81 ISS
Expression Patterns of Glyma03g39860
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma03g39860
Paralog Evidence Comments
Glyma19g42420 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma03g39860 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.03g238700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma03g39860
Coding sequences of Glyma03g39860
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma03g39860.1 sequence type=CDS gene model=Glyma03g39860 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGTGGACGCCTTCAAACTTTGCATCTTCCTTCTTGCGTCGATCTGTGCTTTCCTAGTCTTTTCTAATCCAGTGCTGTGTAGTGATAAGGAGGACAGTGTATTCAAGGGAATCAACAGCTACAGGCAAACACGGAGCCTGGTACCCCTGAGCCAAGTTTCGAAGGCAACATGTTTGGCTGATGAAGTTGCAGAAGAAATAGAGAAGATGCCCTGTGAAAACGTGAACCAATACTACCCTTCATCTGTTCCTGGTAGTGGGAACCTCAAAATCCCAAACTTGCAGAAGCACATAAATAAATGTGACATTAACTTCAACACCACCACTGATGGGGTCATTCTCCCCGTTTGTGTCTCCAAGCTGGAACCAACCATTGTGCTCTCTAATTACACTCATTCTGATCGTTACGCACAGTTTCTCAACAATTCCAAGTACACTGGAGCAGGGCTTGGTTCTGAGGATGATTGGATGGTTCTTGTTCTCACCACCAACACTACCACTGGAAGTTTCTCTGCTGCTGCAACTTCTGTTCGTGCTTATGCTGCTTCTGTGGACTTCTTGCTCTTTGTTTCGTTGTTTGTGCTCATCAACTACCTTGATTGA
Predicted protein sequences of Glyma03g39860
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma03g39860.1 sequence type=predicted peptide gene model=Glyma03g39860 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MVDAFKLCIFLLASICAFLVFSNPVLCSDKEDSVFKGINSYRQTRSLVPLSQVSKATCLADEVAEEIEKMPCENVNQYYPSSVPGSGNLKIPNLQKHINKCDINFNTTTDGVILPVCVSKLEPTIVLSNYTHSDRYAQFLNNSKYTGAGLGSEDDWMVLVLTTNTTTGSFSAAATSVRAYAASVDFLLFVSLFVLINYLD*