Report for Sequence Feature Glyma03g39140
Feature Type: gene_model
Chromosome: Gm03
Start: 45335600
stop: 45337075
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma03g39140
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G62630 AT
Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF1645) | chr3:23163937-23165079 REVERSE LENGTH=380
SoyBase E_val: 1.00E-84 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF07816 PFAM
Protein of unknown function (DUF1645)
JGI ISS
UniRef100_G7I9G3 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Pheromone receptor-like protein n=2 Tax=Medicago truncatula RepID=G7I9G3_MEDTR
SoyBase E_val: 5.00E-110 ISS
UniRef100_I1JR63 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JR63_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma03g39140
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma03g39140
Paralog Evidence Comments
Glyma19g41700 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma03g39140 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.03g232100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma03g39140
Coding sequences of Glyma03g39140
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma03g39140.1 sequence type=CDS gene model=Glyma03g39140 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAGCTCCAAACCCCGAACAATTATGGCGTAACCGAAAACCCAGACACTCCCCTCTTCGAAGACATCGACAGCACCTGCTCCACTCCCTACGTCAGCGCCCCTTCCAGTCCCGGCCGGGAATCCATCTCCGCCGCCGGAGCCGGCTTCTTCTACAGTGCTCCTGCCAGCCCAATGCACTTCACTATATCCGCCGCTTCCACTTACTCACACTCACCCTCTTGGTCTTCCTTGGAAAAAAACTCTTGTTGCGATTTTGAGTTCTCGGCCCGGTTCGGTTCGTCCGGGTTGACTGGTTCGGGTTCGATGAGCTCGGCCGACGAGTTGTTCTTGAACGGTCAGATCCGTCCCATGAAGCTCTCGACCCACTTGGAGCGGCCACAAGTCTTAGCTCCCTTGCTGGATCTCGAAGAAGAAGAAGAGGAAGAAGAAAACGAGGTACGAGGTAGAGATCTGAGGCTGCGAGACAAGTCACTCCGCAGAAGGACCAGATCCCTCTCACCTCTTAGGAACACGCCGTTAGAGTGGACGGAGAACGAGGAAAAAACTGACAAGAAGGAAAACGTGACCCCTTCCGTTTCGAGCGGAAGTGGAAGGAGTTCCAAGAGGTGGGTTTTCTTGAGGGATTTTCTAAGAAGCAAAAGCGAGGGAAGGAGTAATAACAAGTTCTGGTCCACTATTTCCTTTTCCCCCGCCGCCAAGGAAAAGAAGGGAAATGGGCCGCAGAAGCCCAAGAAGGTCGCCGGAAAGCCCACTAACGGCGTCGGGAAGAGGCGCGTGCCGGCGTCGTCGCCGCACGAGTTGCATTATAAAGCCAACCGTGCGCAAGCGGAGGAGTTGAGAAGAAAAACCTTTTTGCCTTATAGGCAGGGCTTGCTTGGGTGCTTGGGATTTAGTTCCAAAGGTTATGGTGCCATGAGTGGCTTTGCTAGAGCCTTAAACCCTGTCTCTTCCAGCTAA
Predicted protein sequences of Glyma03g39140
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma03g39140.1 sequence type=predicted peptide gene model=Glyma03g39140 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MELQTPNNYGVTENPDTPLFEDIDSTCSTPYVSAPSSPGRESISAAGAGFFYSAPASPMHFTISAASTYSHSPSWSSLEKNSCCDFEFSARFGSSGLTGSGSMSSADELFLNGQIRPMKLSTHLERPQVLAPLLDLEEEEEEEENEVRGRDLRLRDKSLRRRTRSLSPLRNTPLEWTENEEKTDKKENVTPSVSSGSGRSSKRWVFLRDFLRSKSEGRSNNKFWSTISFSPAAKEKKGNGPQKPKKVAGKPTNGVGKRRVPASSPHELHYKANRAQAEELRRKTFLPYRQGLLGCLGFSSKGYGAMSGFARALNPVSSS*