SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G09330 | AT | Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: integral to membrane; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF846, eukaryotic (InterPro:IPR008564); Has 518 Blast hits to 518 proteins in 206 species: Archae - 0; Bacteria - 0; Metazoa - 193; Fungi - 145; Plants - 73; Viruses - 0; Other Eukaryotes - 107 (source: NCBI BLink). | chr1:3013003-3014903 | SoyBase | E_val: 1.00E-44 | ISS |
| GO:0007030 | GO-bp | Annotation by Michelle Graham. GO Biological Process: Golgi organization | SoyBase | N/A | ISS |
| GO:0009306 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein secretion | SoyBase | N/A | ISS |
| GO:0009826 | GO-bp | Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth | SoyBase | N/A | ISS |
| GO:0005768 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endosome | SoyBase | N/A | ISS |
| GO:0005794 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus | SoyBase | N/A | ISS |
| GO:0005802 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network | SoyBase | N/A | ISS |
| GO:0016021 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| KOG3195 | KOG | Uncharacterized membrane protein NPD008/CGI-148 | JGI | ISS | |
| PTHR13019 | Panther | UNCHARACTERIZED | JGI | ISS | |
| UniRef100_G7I9I7 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: FAM18-like protein, putative n=2 Tax=Medicago truncatula RepID=G7I9I7_MEDTR | SoyBase | E_val: 1.00E-48 | ISS |
| UniRef100_UPI00023375BB | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI00023375BB related cluster n=1 Tax=unknown RepID=UPI00023375BB | SoyBase | E_val: 1.00E-59 | ISS |
|
Glyma03g38941 not represented in the dataset |
Glyma03g38941 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.03g230100 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma03g38941.1 sequence type=CDS gene model=Glyma03g38941 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGATTGCAAGAAGGCTGCGGCTTTGTCATTTTACATTCTCTCCGCCCTCTTTATTGATAACTTTGTCATCATTTTTGTGATGACTGTCCTTCTTGCCGCTCTTGATTTTTGTGTTTGGAAATTTGAGTGTCTTGATCAGCAGTCATTCGCCCGGATGAACAAGAAAGATTCATGGCTTTTCTGGCTTCAAGCTGATTACCTCCTAGTTGTTGGAGTTTGTTTGACCCTCAGTATTGCAAATATTGTTGGTTTTACCAAATGCCAAATAGATACGAAGAAGCCGATTCAACAATTTGCCTCTCAAACAATTGCCTCACAGGTCTCATCTACATTCAGTGTTGTCTGA
>Glyma03g38941.1 sequence type=predicted peptide gene model=Glyma03g38941 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MDCKKAAALSFYILSALFIDNFVIIFVMTVLLAALDFCVWKFECLDQQSFARMNKKDSWLFWLQADYLLVVGVCLTLSIANIVGFTKCQIDTKKPIQQFASQTIASQVSSTFSVV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
