SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g38910): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g38910): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g38910

Feature Type:gene_model
Chromosome:Gm03
Start:45176179
stop:45179418
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G56600AT Annotation by Michelle Graham. TAIR10: galactinol synthase 2 | chr1:21207620-21209291 FORWARD LENGTH=335 SoyBaseE_val: 0ISS
GO:0006012GO-bp Annotation by Michelle Graham. GO Biological Process: galactose metabolic process SoyBaseN/AISS
GO:0006979GO-bp Annotation by Michelle Graham. GO Biological Process: response to oxidative stress SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0016051GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate biosynthetic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0016757GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups SoyBaseN/AISS
GO:0016758GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring hexosyl groups SoyBaseN/AISS
GO:0047216GO-mf Annotation by Michelle Graham. GO Molecular Function: inositol 3-alpha-galactosyltransferase activity SoyBaseN/AISS
KOG1950 KOG Glycosyl transferase, family 8 - glycogenin JGI ISS
PTHR11183Panther GLYCOGENIN JGI ISS
PTHR11183:SF2Panther GLYCOGENIN-RELATED JGI ISS
PF01501PFAM Glycosyl transferase family 8 JGI ISS
UniRef100_A0EVX3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Galactinol synthase n=1 Tax=Ammopiptanthus mongolicus RepID=A0EVX3_9FABA SoyBaseE_val: 0ISS
UniRef100_UPI0000F1C1F9UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0000F1C1F9 related cluster n=1 Tax=unknown RepID=UPI0000F1C1F9 SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g38910 not represented in the dataset

Glyma03g38910 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g229800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g38910.1   sequence type=CDS   gene model=Glyma03g38910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCACCTAACATCACCACCGTTGTTGCCAATGCCACCACTGAGCAATTACCCAAAGCTCATGGAGGAAGTAGTGGGCGTGCCTTTGTGACTTTTCTTGCTGGAAACGGTGATTATGTAAAGGGTGTTGTGGGTTTGGCCAAAGGACTGAGAAAGGCCAAAAGCATGTACCCTTTGGTGGTTGCTGTGTTACCAGATGTTCCTGAAGAACATCGTGCGATTCTCAAATCCCAAGGTTGCATTGTCAGGGAGATTGAACCTGTGTACCCTCCTAAGAACCAGACCCAGTTCGCCATGGCCTATTATGTCATCAATTACTCCAAGCTACGTATTTGGGAGTTCGTGGAGTACCAGAAGATGATATACCTAGACGGCGACATCCAAGTTTTTGGAAACATTGACCACTTGTTTGATCTTCCTAATAATTATTTCTATGCGGTGATGGATTGTTTCTGCGAGAAGACTTGGAGCCACACCCCTCAGTTCCAGATTGGGTACTGCCAACAGTGCCCTGATAAGGTTCAATGGCCCTCTCACTTTGGTACCAAACCTCCTCTATATTTCAATGCTGGCATGTTTGTTTATGAGCCTAATCTCAACACCTACCGTCATCTTCTCCAAACTGTCCAAGTCATCAAGCCCACGTCCTTTGCTGAGCAGGACTTTCTGAACATGTACTTCAAGGACAAGTACAAGCCAATACCGAACGTGTACAACCTTGTGCTGGCCATGTTGTGGCGTCACCCTGAGAATGTTGAACTTGATCAAGTTCAAGTGGTTCATTACTGTGCTGCTGGGTCTAAGCCTTGGAGGTTCACTGGGAAGGAAGAGAACATGGATAGGGAAGATATCAAGATGCTTATGAAGAAGTGGTGGGACATATATGAAGATGAGACACTGGACTACAATAACAACTCTGTCAATGTGGAACGTTTCACATCAGTACTATTGGATGCTGGGGGTTTTCAGTTTGTGCCAGCACCTTCTGCTGCCTAA

>Glyma03g38910.1   sequence type=predicted peptide   gene model=Glyma03g38910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPNITTVVANATTEQLPKAHGGSSGRAFVTFLAGNGDYVKGVVGLAKGLRKAKSMYPLVVAVLPDVPEEHRAILKSQGCIVREIEPVYPPKNQTQFAMAYYVINYSKLRIWEFVEYQKMIYLDGDIQVFGNIDHLFDLPNNYFYAVMDCFCEKTWSHTPQFQIGYCQQCPDKVQWPSHFGTKPPLYFNAGMFVYEPNLNTYRHLLQTVQVIKPTSFAEQDFLNMYFKDKYKPIPNVYNLVLAMLWRHPENVELDQVQVVHYCAAGSKPWRFTGKEENMDREDIKMLMKKWWDIYEDETLDYNNNSVNVERFTSVLLDAGGFQFVPAPSAA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo