Glyma03g38581 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g38581

Feature Type:	gene_model
Chromosome:	Gm03
Start:	44903013
stop:	44903930
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g38581

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G26731	AT	Annotation by Michelle Graham. TAIR10: unknown protein; Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). \| chr5:9295676-9295975 FORWARD LENGTH=99	SoyBase	E_val: 1.00E-17	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_I1NBL3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NBL3_SOYBN	SoyBase	E_val: 2.00E-51	ISS
UniRef100_Q94EW8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: AT5g26741 n=1 Tax=Arabidopsis thaliana RepID=Q94EW8_ARATH	SoyBase	E_val: 6.00E-15	ISS

Expression Patterns of Glyma03g38581

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g38581 not represented in the dataset	Glyma03g38581 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g38581

Paralog	Evidence	Comments
Glyma19g41171	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g38581 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g226900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g38581

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g38581

Limit To All Plant Sequences

>Glyma03g38581.1   sequence type=CDS   gene model=Glyma03g38581   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCCATGATTAGTAATAATCAAAAGGGTAGCTTTAACATGAATCCGTTATTTAGGAGTGATTCTTTTGGGCATTACTACCCTGAGGCTGAACACAGTTACACTATGATGGAGAAGAGGCAATTGTTCCTCAGAAGCTATCAGTTCTGTAGAAAGAAGAGCCTCAAAGAGAGAGTCAAAGGGTCTTTGGTTCGTGTCAAGAAGGTTCTGTGGCTGAGGCTAAGATCTGCTAAGAAACTCAGAAGGTTGTTTTTTTCCAGAATCAGAATCAAATGCGGCTTCTATTACCGGAGGAGAAGGTTTTCACGCCTTCTCAGTGCCCATAACCGCAAAATAGACTCTTCCTCTTGTTTATGGTAG

Predicted protein sequences of Glyma03g38581

Limit To All Plant Sequences

>Glyma03g38581.1   sequence type=predicted peptide   gene model=Glyma03g38581   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPMISNNQKGSFNMNPLFRSDSFGHYYPEAEHSYTMMEKRQLFLRSYQFCRKKSLKERVKGSLVRVKKVLWLRLRSAKKLRRLFFSRIRIKCGFYYRRRRFSRLLSAHNRKIDSSSCLW*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain