SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma03g37870

Feature Type:gene_model
Chromosome:Gm03
Start:44338246
stop:44340268
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G34830AT Annotation by Michelle Graham. TAIR10: WRKY DNA-binding protein 35 | chr2:14693839-14696378 REVERSE LENGTH=427 SoyBaseE_val: 4.00E-37ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006826GO-bp Annotation by Michelle Graham. GO Biological Process: iron ion transport SoyBaseN/AISS
GO:0009555GO-bp Annotation by Michelle Graham. GO Biological Process: pollen development SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0010106GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion starvation SoyBaseN/AISS
GO:0010167GO-bp Annotation by Michelle Graham. GO Biological Process: response to nitrate SoyBaseN/AISS
GO:0015706GO-bp Annotation by Michelle Graham. GO Biological Process: nitrate transport SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
PF03106PFAM WRKY DNA -binding domain JGI ISS
UniRef100_G7KSU4UniRef Annotation by Michelle Graham. Most informative UniRef hit: WRKY transcription factor n=1 Tax=Medicago truncatula RepID=G7KSU4_MEDTR SoyBaseE_val: 1.00E-122ISS
UniRef100_I1JQS9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JQS9_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma19g40470 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g220100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g37870.1   sequence type=CDS   gene model=Glyma03g37870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACAATAATACTAGTGCCTGTGCCTACCCCCAACTTGAGTCAGAAGAAGCATCTTCAGAGCACAAATCAGAAACTCAAACATCAAAGAAAAGGAAAATGGTTGAGAAAACAGTTGTGGCAGTGAGGGTAGGAGAGAAGGTTGGCAAGCTAAAGAATGAAGGGCTACCCTCAGATTTTTGGTCTTGGAGGAAATATGGACAAAAACCAATCAAAGGGTCTCCATATCCAAGGGGCTATTACAAGTGCAGCACATCCAAAGGTTGTTCAGCCAAAAAGCAAGTAGAGAGATGCAGAACGGATGCTTCAATGCTCATAATCACATATACCTCTACACATAACCATCCATGTCCCACTCCCATCACTACAAAATCTACCACCACAAAGGAGGAAGACCAAGAACATATAGAACTAGAAGAAGAAGAAGAGCAAAGGGATAATAATAATAATAAGCCCAGTGATGAAGTTACTAATGAAGAAAATTTTCATTACTTGCAATCTCCAATACGTTGCTCCAGCCAAGATATCATTATAGAACAAGAAGATCCTTTCAAACTAAACACGGAGAAAAGCCATGATCGAATGGATCTCCTCTTAGAGGAAGAGCCTCTTTGTTTTGCACAGCTCAAGAACTTGTCTGCTTCCAAAAACGAAGAACTTGACTTTTTCGATGAGCTTGAGGAGTTACCCATGTCTTCATCTTTGTTGCACTTTACGAGGAACATTTTTTCCGATGAAAGGATTCCCGTTGGCCCTTCTTGA

>Glyma03g37870.1   sequence type=predicted peptide   gene model=Glyma03g37870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDNNTSACAYPQLESEEASSEHKSETQTSKKRKMVEKTVVAVRVGEKVGKLKNEGLPSDFWSWRKYGQKPIKGSPYPRGYYKCSTSKGCSAKKQVERCRTDASMLIITYTSTHNHPCPTPITTKSTTTKEEDQEHIELEEEEEQRDNNNNKPSDEVTNEENFHYLQSPIRCSSQDIIIEQEDPFKLNTEKSHDRMDLLLEEEPLCFAQLKNLSASKNEELDFFDELEELPMSSSLLHFTRNIFSDERIPVGPS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo