Glyma03g37870 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g37870

Feature Type:	gene_model
Chromosome:	Gm03
Start:	44338246
stop:	44340268
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g37870

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G34830	AT	Annotation by Michelle Graham. TAIR10: WRKY DNA-binding protein 35 \| chr2:14693839-14696378 REVERSE LENGTH=427	SoyBase	E_val: 4.00E-37	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0006826	GO-bp	Annotation by Michelle Graham. GO Biological Process: iron ion transport	SoyBase	N/A	ISS
GO:0009555	GO-bp	Annotation by Michelle Graham. GO Biological Process: pollen development	SoyBase	N/A	ISS
GO:0009793	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy	SoyBase	N/A	ISS
GO:0010106	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion starvation	SoyBase	N/A	ISS
GO:0010167	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to nitrate	SoyBase	N/A	ISS
GO:0015706	GO-bp	Annotation by Michelle Graham. GO Biological Process: nitrate transport	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0043565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding	SoyBase	N/A	ISS
PF03106	PFAM	WRKY DNA -binding domain	JGI		ISS
UniRef100_G7KSU4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: WRKY transcription factor n=1 Tax=Medicago truncatula RepID=G7KSU4_MEDTR	SoyBase	E_val: 1.00E-122	ISS
UniRef100_I1JQS9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JQS9_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma03g37870

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g37870

Paralog	Evidence	Comments
Glyma19g40470	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g37870 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g220100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g37870

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g37870

Limit To All Plant Sequences

>Glyma03g37870.1   sequence type=CDS   gene model=Glyma03g37870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACAATAATACTAGTGCCTGTGCCTACCCCCAACTTGAGTCAGAAGAAGCATCTTCAGAGCACAAATCAGAAACTCAAACATCAAAGAAAAGGAAAATGGTTGAGAAAACAGTTGTGGCAGTGAGGGTAGGAGAGAAGGTTGGCAAGCTAAAGAATGAAGGGCTACCCTCAGATTTTTGGTCTTGGAGGAAATATGGACAAAAACCAATCAAAGGGTCTCCATATCCAAGGGGCTATTACAAGTGCAGCACATCCAAAGGTTGTTCAGCCAAAAAGCAAGTAGAGAGATGCAGAACGGATGCTTCAATGCTCATAATCACATATACCTCTACACATAACCATCCATGTCCCACTCCCATCACTACAAAATCTACCACCACAAAGGAGGAAGACCAAGAACATATAGAACTAGAAGAAGAAGAAGAGCAAAGGGATAATAATAATAATAAGCCCAGTGATGAAGTTACTAATGAAGAAAATTTTCATTACTTGCAATCTCCAATACGTTGCTCCAGCCAAGATATCATTATAGAACAAGAAGATCCTTTCAAACTAAACACGGAGAAAAGCCATGATCGAATGGATCTCCTCTTAGAGGAAGAGCCTCTTTGTTTTGCACAGCTCAAGAACTTGTCTGCTTCCAAAAACGAAGAACTTGACTTTTTCGATGAGCTTGAGGAGTTACCCATGTCTTCATCTTTGTTGCACTTTACGAGGAACATTTTTTCCGATGAAAGGATTCCCGTTGGCCCTTCTTGA

Predicted protein sequences of Glyma03g37870

Limit To All Plant Sequences

>Glyma03g37870.1   sequence type=predicted peptide   gene model=Glyma03g37870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDNNTSACAYPQLESEEASSEHKSETQTSKKRKMVEKTVVAVRVGEKVGKLKNEGLPSDFWSWRKYGQKPIKGSPYPRGYYKCSTSKGCSAKKQVERCRTDASMLIITYTSTHNHPCPTPITTKSTTTKEEDQEHIELEEEEEQRDNNNNKPSDEVTNEENFHYLQSPIRCSSQDIIIEQEDPFKLNTEKSHDRMDLLLEEEPLCFAQLKNLSASKNEELDFFDELEELPMSSSLLHFTRNIFSDERIPVGPS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain