SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g37490): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g37490): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g37490

Feature Type:gene_model
Chromosome:Gm03
Start:44090807
stop:44092585
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g37490
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G71000AT Annotation by Michelle Graham. TAIR10: Chaperone DnaJ-domain superfamily protein | chr1:26769336-26770111 REVERSE LENGTH=165 SoyBaseE_val: 1.00E-29ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0042542GO-bp Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0031072GO-mf Annotation by Michelle Graham. GO Molecular Function: heat shock protein binding SoyBaseN/AISS
PTHR24077Panther FAMILY NOT NAMED JGI ISS
PTHR24077:SF88Panther JGI ISS
PF00226PFAM DnaJ domain JGI ISS
UniRef100_B9SAW5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Heat shock protein binding protein, putative n=1 Tax=Ricinus communis RepID=B9SAW5_RICCO SoyBaseE_val: 1.00E-47ISS
UniRef100_UPI000189D8B5UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000189D8B5 related cluster n=1 Tax=unknown RepID=UPI000189D8B5 SoyBaseE_val: 5.00E-109ISS

Expression Patterns of Glyma03g37490
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g37490 not represented in the dataset
Glyma03g37490 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g37490
ParalogEvidenceComments
Glyma19g40110 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g37490 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g216900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g37490
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g37490
>Glyma03g37490.1   sequence type=CDS   gene model=Glyma03g37490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGGGCACCGTCGAGTCAAACGGTGCCGTTTGTTATTATTCAGAGCTTGGGATTGTCAAACATTGCACCGACGACGAAATTCGATGCGCTTATCGTAAGATGGCTCTGAAGTGGCATCCTGATAGGTGGATCAAGGACCCTAAGCTTGCACTAGAAGCTAAAAACCGATTCCTGCGCGTACAAGAGGCTTATTCAGTTTTGTCTAATAAAGGGAAGAGAAGGATATATGATGCTGGCTTGTTTGGTCTGATCGGAGAGGATGATGATGAGGGATTTCTTGATTTCATGCAAGAAATGGCCTTGATGATGCAGAAAGTGAGACCCAAGGATGAGAAAGGCATGTTGGAGGATCTTCAAGGATTGTTAATCGATAAGATGGCAGATAATGAAGGGATGGAAAAGTCTGGGTTAAGCTGGAATTCATCTCCATGTCCTACAAAAAGGGCACGTATCTTATGA
Predicted protein sequences of Glyma03g37490
>Glyma03g37490.1   sequence type=predicted peptide   gene model=Glyma03g37490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLGTVESNGAVCYYSELGIVKHCTDDEIRCAYRKMALKWHPDRWIKDPKLALEAKNRFLRVQEAYSVLSNKGKRRIYDAGLFGLIGEDDDEGFLDFMQEMALMMQKVRPKDEKGMLEDLQGLLIDKMADNEGMEKSGLSWNSSPCPTKRARIL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo