|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G15802 | AT | Annotation by Michelle Graham. TAIR10: heat shock factor binding protein | chr4:8986864-8988339 REVERSE LENGTH=86 | SoyBase | E_val: 1.00E-11 | ISS |
| GO:0009408 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to heat | SoyBase | N/A | ISS |
| GO:0048316 | GO-bp | Annotation by Michelle Graham. GO Biological Process: seed development | SoyBase | N/A | ISS |
| GO:0070370 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular heat acclimation | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005794 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0031072 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: heat shock protein binding | SoyBase | N/A | ISS |
| PF06825 | PFAM | Heat shock factor binding protein 1 | JGI | ISS | |
| UniRef100_I1JQK8 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JQK8_SOYBN | SoyBase | E_val: 6.00E-25 | ISS |
|
Glyma03g37121 not represented in the dataset |
Glyma03g37121 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.03g213100 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma03g37121.1 sequence type=CDS gene model=Glyma03g37121 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCATATTTACACAACAGCCCAGGTGGTTTATTATTTCTGCACACAGTTACATCTATAAACTCAAGACATCCACCTGTGCAAGTTGTCATATGTTGGCTAAGCCAGGATGGGCAACGATGCCAATTCTATTACATAATTATTGGTTCAAATTGCTCAAGTAATGTGTTTCTTGACATCGTCATTGCACTTGATGAGATGGGAGACCGTATAAATGAGTTGGAGCAAAGCATCAATGATTTAAGATCAGAGATGGGAGTGGAGAGCACTCCATCACCTGTGGCCCCTGCTAAGCCAAAGGAAGAAGAGTCAAACAAAGAAGAGGGTTCTGCTTGA
>Glyma03g37121.1 sequence type=predicted peptide gene model=Glyma03g37121 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAYLHNSPGGLLFLHTVTSINSRHPPVQVVICWLSQDGQRCQFYYIIIGSNCSSNVFLDIVIALDEMGDRINELEQSINDLRSEMGVESTPSPVAPAKPKEEESNKEEGSA*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||