Glyma03g36735 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g36735

Feature Type:	gene_model
Chromosome:	Gm03
Start:	43608992
stop:	43613594
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g36735

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G03470	AT	Annotation by Michelle Graham. TAIR10: Kinase interacting (KIP1-like) family protein \| chr1:866217-867493 REVERSE LENGTH=269	SoyBase	E_val: 5.00E-51	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0005884	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: actin filament	SoyBase	N/A	ISS
GO:0031965	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nuclear membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF07765	PFAM	KIP1-like protein	JGI		ISS
UniRef100_D7KCF2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Kinase interacting family protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7KCF2_ARALL	SoyBase	E_val: 2.00E-45	ISS
UniRef100_I1JQG6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JQG6_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma03g36735

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g36735 not represented in the dataset	Glyma03g36735 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g36735

Paralog	Evidence	Comments
Glyma19g39385	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g36735 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g209100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g36735

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g36735

Limit To All Plant Sequences

>Glyma03g36735.1   sequence type=CDS   gene model=Glyma03g36735   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTGGAATGACGAAGAATCAACCGTCACAGTGGTGGTGGCTTGATAGCCACACCACTTCTAATCGATCCCCTTGGCTTCAATCCACTCTCTCTGAGCTTAATGAGAAGACAAGGGCAATGTTAAAGTTAATTGAAGAGGATGCAGATTCCTTTGCCAAACGTGCAGAGATGTATTACAAGAAGCGACCAGAGCTTGTGAGCATGGTTGAGGATTTCTACAGGACACATCGCTCCCTAGCTGAGCGCTATGATCAAGTCAAACCTGATACTACTGGAATTGGACACCTCATTACTGGGGGGTCACCTTTTGCTTCAGCAAAGCATCAGTTGGAGAAGTTGATGACTTTTTCAGATAATGGATATGATACCTATTCTGAGCATTGTGATGTGTACGAGTCTGAGGAATCTGAAGTTGATGATCCTGAACAGGAGGAGGATGAAGAGGGGACCAAGTTTCTTCATAACAGCATAAAAAATGAGCAAGTTTCGTTTGTGGCAGCGAGTGATGTTGAAGTGATGAAGCTGAGGGGTGAAGTTAAGAGACTCAATGAAGAGAACAAGGCTCATAGGGATCAAATCAAGCAGAAGGATACCATTTGTGATGAAATCATGATGCTGAGGGAAGAAATTGGAAGGCTTAGAGATGAGAATGAGGCACAGAAGGAACAACTCAAGCAGAAGGATGAAGAGAAGATTGAGGTGATAAGACAGCTGAGTTTAGCAATAGATGTGCTGAAGCAGGAGAATGTGAAGATGAGAAACTTCATTGCTAAGGAGTCCACCAAGAAATGGAAGAACCCATTTGAGATCAACAAACTTGTGGGAGCATTTTCTGTGAAGTTGTTCAGTGGTGGTACTCCAAAGAATCAGCCCGGCGTTGAGCTCTCTAGATGTGGTTAA

Predicted protein sequences of Glyma03g36735

Limit To All Plant Sequences

>Glyma03g36735.1   sequence type=predicted peptide   gene model=Glyma03g36735   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTGMTKNQPSQWWWLDSHTTSNRSPWLQSTLSELNEKTRAMLKLIEEDADSFAKRAEMYYKKRPELVSMVEDFYRTHRSLAERYDQVKPDTTGIGHLITGGSPFASAKHQLEKLMTFSDNGYDTYSEHCDVYESEESEVDDPEQEEDEEGTKFLHNSIKNEQVSFVAASDVEVMKLRGEVKRLNEENKAHRDQIKQKDTICDEIMMLREEIGRLRDENEAQKEQLKQKDEEKIEVIRQLSLAIDVLKQENVKMRNFIAKESTKKWKNPFEINKLVGAFSVKLFSGGTPKNQPGVELSRCG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain