Glyma03g36591 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g36591): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g36591): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g36591

Feature Type:	gene_model
Chromosome:	Gm03
Start:	43521533
stop:	43522529
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g36591

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G27880	AT	Annotation by Michelle Graham. TAIR10: Argonaute family protein \| chr2:11871488-11876712 FORWARD LENGTH=997	SoyBase	E_val: 1.00E-22	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0048441	GO-bp	Annotation by Michelle Graham. GO Biological Process: petal development	SoyBase	N/A	ISS
GO:0048443	GO-bp	Annotation by Michelle Graham. GO Biological Process: stamen development	SoyBase	N/A	ISS
GO:0048481	GO-bp	Annotation by Michelle Graham. GO Biological Process: ovule development	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
PTHR22891	Panther	EUKARYOTIC TRANSLATION INITIATION FACTOR 2C	JGI		ISS
PF08699	PFAM	Domain of unknown function (DUF1785)	JGI		ISS
UniRef100_B9GEQ1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Argonaute protein group n=1 Tax=Populus trichocarpa RepID=B9GEQ1_POPTR	SoyBase	E_val: 2.00E-24	ISS
UniRef100_UPI00023372B1	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI00023372B1 related cluster n=1 Tax=unknown RepID=UPI00023372B1	SoyBase	E_val: 9.00E-67	ISS

Expression Patterns of Glyma03g36591

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g36591 not represented in the dataset	Glyma03g36591 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g36591 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g207800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g36591

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g36591

Limit To All Plant Sequences

>Glyma03g36591.1   sequence type=CDS   gene model=Glyma03g36591   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTCAAGCCTCTGAATCCCTCTCTCATCGTCTTTGGCCCAGGAACCCCACCATCATCCTCGTCCATCGTCTTCGGCACAGTACTCCCACAATTTTTTCTTCTTCTTTTTCTTTTTTTTTTTGTAAAATGTAGGTTCGTTGTTGTGGGAAGATCGTTCTTCTCGTCTTCTTTGGGGAAACCTGGAACGCTTGGTAGTGGAACGGAGTACTGGAGGGGCTATTACCAGAGCCTTCGCCCAACTCAGATGGGCCTGTCTCTTAACATTAATGTGTCGGCCAGGGCATTTTATGAGCCTATTCCTGCGATTGATTTCATTGAAAGTCATTTTAGGGTCAATCCTTCCAGGCCGAATCAAGCCATGGTTTATGATTCAATCGCCGCCGTGCTGATTCCCTCCGCCGCAAACACTAGGAATCCGAGGAAGAAGAAGAGGGTTTGA

Predicted protein sequences of Glyma03g36591

Limit To All Plant Sequences

>Glyma03g36591.1   sequence type=predicted peptide   gene model=Glyma03g36591   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LKPLNPSLIVFGPGTPPSSSSIVFGTVLPQFFLLLFLFFFVKCRFVVVGRSFFSSSLGKPGTLGSGTEYWRGYYQSLRPTQMGLSLNINVSARAFYEPIPAIDFIESHFRVNPSRPNQAMVYDSIAAVLIPSAANTRNPRKKKRV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain