SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g36230

Feature Type:gene_model
Chromosome:Gm03
Start:43240056
stop:43242597
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g36230
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G35900AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: nucleus; EXPRESSED IN: 20 plant structures; EXPRESSED DURING: 13 growth stages; Has 32 Blast hits to 32 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 32; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr2:15070203-15071540 REVERSE LENGTH=192 SoyBaseE_val: 9.00E-49ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_C6T2Q7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T2Q7_SOYBN SoyBaseE_val: 2.00E-129ISS
UniRef100_Q6X182UniRef Annotation by Michelle Graham. Most informative UniRef hit: Mal d 1-associated protein n=1 Tax=Malus x domestica RepID=Q6X182_MALDO SoyBaseE_val: 1.00E-57ISS

Expression Patterns of Glyma03g36230
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g36230
ParalogEvidenceComments
Glyma19g38880 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g36230 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g204000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g36230
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g36230
>Glyma03g36230.1   sequence type=CDS   gene model=Glyma03g36230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGTGGGTTTGGAAGGATGACAACAGCGACGATGTTCGACGCGATAACTCTTCGGAACGATGCGCCACCACCAAGGTCGTCAAATCTCAGTGCAGAACAGAGGAGGTCGAAACTGGAAAGTTCGTCAGAAAGTGCGAGAAAACCGAAGAGATTCTCAGGAATTGCATCGGAAAGCCCGCCGAAGTGTTGCAATCAAACAAAGAGTATACTGAAGAGGATATCACAGATGAAGTACTTAAAGGAAGGTCTGTTCCATTTAGCTCATCTGACGGTGCCAGTGGTGTGGTTGACTTTCCTGGGCTACAAAATGATATTGAAGTCATGGAACGTAACCTGTTAAGTGGTCTCAGTCATTTCTTCGACGCAGCGAATGGGTTTTTTGATGTTTTTTCCAAGTCTCCAAGCATCTTTGATGCAGAGTCATCCTCACCCTCTGTGAGGAGAGGGATACCTATTGAAGAATATCGTCGGCCAGAAGCTTATCCTAAATCCAAGGAGAAGGAATCAGGAGATACTGATTTTGTTGCAATGGCTAAAGATGTTTAA
Predicted protein sequences of Glyma03g36230
>Glyma03g36230.1   sequence type=predicted peptide   gene model=Glyma03g36230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGWVWKDDNSDDVRRDNSSERCATTKVVKSQCRTEEVETGKFVRKCEKTEEILRNCIGKPAEVLQSNKEYTEEDITDEVLKGRSVPFSSSDGASGVVDFPGLQNDIEVMERNLLSGLSHFFDAANGFFDVFSKSPSIFDAESSSPSVRRGIPIEEYRRPEAYPKSKEKESGDTDFVAMAKDV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo