SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g36090

Feature Type:gene_model
Chromosome:Gm03
Start:43102540
stop:43103430
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g36090
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G11840AT Annotation by Michelle Graham. TAIR10: plant U-box 24 | chr3:3736578-3738250 REVERSE LENGTH=470 SoyBaseE_val: 3.00E-60ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0002679GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response SoyBaseN/AISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006952GO-bp Annotation by Michelle Graham. GO Biological Process: defense response SoyBaseN/AISS
GO:0009595GO-bp Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0009693GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene biosynthetic process SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0035556GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0043900GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0051865GO-bp Annotation by Michelle Graham. GO Biological Process: protein autoubiquitination SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0004842GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity SoyBaseN/AISS
PTHR13931Panther UBIQUITINATION FACTOR E4 JGI ISS
PTHR13931:SF9Panther UNCHARACTERIZED JGI ISS
PF04564PFAM U-box domain JGI ISS
UniRef100_B9SDI6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Spotted leaf protein, putative n=1 Tax=Ricinus communis RepID=B9SDI6_RICCO SoyBaseE_val: 7.00E-110ISS
UniRef100_I1JQ94UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JQ94_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma03g36090
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g36090 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g202500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g36090
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g36090
>Glyma03g36090.1   sequence type=CDS   gene model=Glyma03g36090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATGAAATTGAAGTTCCAAAGTATTTCATCTGCCCTATATCCCTTCAAATCATGAAAGACCCGGTAACCACTATAACAGGTATCACATACGACCGAGACAGCATTGAACACTGGCTATTCACCAACAAAAGCACCACATGCCCAATCACAAGACAACCTCTCCCTAAACACTCTGACCTAACCCCAAATCACACCCTTCTCCGCCTAATCCAATTTTGGTGCACCCAAAATTGTATTCATAGGGTTCCCACACCTAAGCCACCACTTAACAAGTTACAAGTCCTCAAGCTTCTCAAAGATATCAAGGACCCCAACTTGCAACTCAAAACGATCAAGGAATTGAAATTGCTAGCAACTCGAAACGAGAGAAATAATATTAACAAATGTTTGTTACTTCAGGCTGGTGTCCCAAAGGCCATGATCTTATTCATGTTGACTTGTTTTAGAAAAAGTCAATTTGATAAGGCTCTAGAAGAAGCTTTAAGTTTATTGCAACTTGTTGATGTGCCAGAAGAGGAAATAAAGCTTCTTCTAGCAGAGAAAAATGATCAAATATTGGATTCCCTAACGCGGGTTTTGGGCTCTGATGAGATGGAGAATTCAATTGCTGTGAAGTCCCATGCATTGATGTTACTCAACACATTCATGCAAGAAGCTAGCTCCAGCGTAATGGAAAGTGGGACTAACCAACAAGACACGAAGGCTGCTTTTCATGCCATGTTAATCGCTTGCCACTGGGGGAGAAACAGGATCATGATGGTTGAAAGTGGTGCAGTTTTTGAGCTCATAGAGATTGAATTATTGACGCCTGAAAAGAGAACCACGGAACTCACGATGGAGATACTGTTTCGTCTGTGTTCTTGTGCTGAGGTGTCATTGCTTTGTTGA
Predicted protein sequences of Glyma03g36090
>Glyma03g36090.1   sequence type=predicted peptide   gene model=Glyma03g36090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDEIEVPKYFICPISLQIMKDPVTTITGITYDRDSIEHWLFTNKSTTCPITRQPLPKHSDLTPNHTLLRLIQFWCTQNCIHRVPTPKPPLNKLQVLKLLKDIKDPNLQLKTIKELKLLATRNERNNINKCLLLQAGVPKAMILFMLTCFRKSQFDKALEEALSLLQLVDVPEEEIKLLLAEKNDQILDSLTRVLGSDEMENSIAVKSHALMLLNTFMQEASSSVMESGTNQQDTKAAFHAMLIACHWGRNRIMMVESGAVFELIEIELLTPEKRTTELTMEILFRLCSCAEVSLLC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo