| 
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code | 
|---|---|---|---|---|---|
| AT4G31400 | AT | Annotation by Michelle Graham. TAIR10: damaged DNA binding;DNA-directed DNA polymerases | chr4:15237411-15239266 FORWARD LENGTH=345 | SoyBase | E_val: 1.00E-14 | ISS | 
| GO:0006281 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA repair | SoyBase | N/A | ISS | 
| GO:0007062 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion | SoyBase | N/A | ISS | 
| GO:0009553 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo sac development | SoyBase | N/A | ISS | 
| GO:0009790 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development | SoyBase | N/A | ISS | 
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS | 
| GO:0003684 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: damaged DNA binding | SoyBase | N/A | ISS | 
| GO:0003887 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA-directed DNA polymerase activity | SoyBase | N/A | ISS | 
| UniRef100_G7IMD6 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: N-acetyltransferase ESCO2 n=1 Tax=Medicago truncatula RepID=G7IMD6_MEDTR | SoyBase | E_val: 1.00E-13 | ISS | 
| UniRef100_I1NAU8 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1NAU8_SOYBN | SoyBase | E_val: 1.00E-33 | ISS | 
| 
			 Glyma03g36021 not represented in the dataset  | 
			 Glyma03g36021 not represented in the dataset  | 
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection  | 
			Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome  | 
| Corresponding Name | Annotation Version | Evidence | Comments | 
|---|---|---|---|
| Glyma.03g201800 | Wm82.a2.v1 | IGC | As supplied by JGI | 
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183  | 
    
>Glyma03g36021.1 sequence type=CDS gene model=Glyma03g36021 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCAGTCCAAAATCAACGCTTTCTTCAAATCTACTACCTCTGATTCCTCTTCCGCTTCTCTGGACATCTGGGAGAACCAGCAACACCATATCATCAACACCTACACCCGAAGGCGTCCAAAGCTTAACGCCGTTATTCCTTCGGTGGTAAAAAACAAGAAGAGGAGCTACGCCCAATTCCACCTCGATTTCGGCCAATCTGATTTCCTCTTACGCGCATGTTCCACTTGCCGCTTCAAGTTGGACCAAAGAAAATGTTTTCCCTCCACCCAGCGTAGAAACGGGTCGAATAATTTTGGTATCGGAGAACGACCTCACTTCTCACCGAAAAAAATGTTGAGGAGGTCGTGA
>Glyma03g36021.1 sequence type=predicted peptide gene model=Glyma03g36021 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MQSKINAFFKSTTSDSSSASLDIWENQQHHIINTYTRRRPKLNAVIPSVVKNKKRSYAQFHLDFGQSDFLLRACSTCRFKLDQRKCFPSTQRRNGSNNFGIGERPHFSPKKMLRRS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||