SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g36000

Feature Type:gene_model
Chromosome:Gm03
Start:43006097
stop:43007621
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g36000
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G11660AT Annotation by Michelle Graham. TAIR10: NDR1/HIN1-like 1 | chr3:3679031-3679660 REVERSE LENGTH=209 SoyBaseE_val: 1.00E-96ISS
GO:0051607GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to virus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF03168PFAM Late embryogenesis abundant protein JGI ISS
UniRef100_C6TMR7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TMR7_SOYBN SoyBaseE_val: 4.00E-152ISS
UniRef100_E4MXF7UniRef Annotation by Michelle Graham. Most informative UniRef hit: mRNA, clone: RTFL01-27-A10 n=1 Tax=Eutrema halophilum RepID=E4MXF7_THEHA SoyBaseE_val: 6.00E-89ISS

Expression Patterns of Glyma03g36000
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g36000
ParalogEvidenceComments
Glyma19g38600 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g36000 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g201600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g36000
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g36000
>Glyma03g36000.2   sequence type=CDS   gene model=Glyma03g36000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCTTACCATATCATTTCAAGACCTTAAAGTACCAAACTTCCAACTCTTCTCTCTTCTCTCTTCACTCTTCACTCTTGTCGTCATTTCCTCACAAAACCAGTGTCCGTAACATCTCCACCTTAACGATGTCGGTAAAGGAGTGTCACCACCACAAGGGAAAGAAGCACAAACTCTGGAGACGCATCTTCTGGGGCATAGTGATCTTCGCCTTCATCGTGTTGCTAACAGTTCTTATAATCTGGGCAATCCTAAAGCCTTCAAAGCCAACCTTCATCCTCCAAGACGTGACCGTCTACGGCTTCAACGCCACCATCCCCAACTTCCTCACCTCAAGCTTTCAGGTCACGCTTTCCTCGCGCAACCCCAACGACAAAATCGGAGTCTACTACGACCGTCTCGACACCTACGTCACTTACCGGAACCAGCAGGTCACGTACCGAACCTCAATCCCACCCTCATACCAAGGTCACAAGGAAGAGGATGTGTGGTCCCCATTCGTCTTCGGCACTAACGTCCCCGTCGCACCCTTCAACTTCGTTGGTCTCAGTCAAGACCAGACCAACGGCAACGTCCTCGTCCTCGTTAAGATTGACGGTAAGGTACGATGGAAAGTTGGTACCTTCGTCTCTGGTCACTACAACCTCTATGTAAGGTGCCCTGCTTTCATAACTTTTGGCCCCCAAAGCACCGGGATTGCCCTTGGCAAGAACGCCGTTAAGTATCAATTGGTTCAACGCTGCACCGTCGGGGTTTGA
Predicted protein sequences of Glyma03g36000
>Glyma03g36000.2   sequence type=predicted peptide   gene model=Glyma03g36000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MILPYHFKTLKYQTSNSSLFSLHSSLLSSFPHKTSVRNISTLTMSVKECHHHKGKKHKLWRRIFWGIVIFAFIVLLTVLIIWAILKPSKPTFILQDVTVYGFNATIPNFLTSSFQVTLSSRNPNDKIGVYYDRLDTYVTYRNQQVTYRTSIPPSYQGHKEEDVWSPFVFGTNVPVAPFNFVGLSQDQTNGNVLVLVKIDGKVRWKVGTFVSGHYNLYVRCPAFITFGPQSTGIALGKNAVKYQLVQRCTVGV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo