SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g35950

Feature Type:gene_model
Chromosome:Gm03
Start:42990267
stop:42990890
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g35950
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G35980AT Annotation by Michelle Graham. TAIR10: Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family | chr2:15110635-15111318 FORWARD LENGTH=227 SoyBaseE_val: 2.00E-54ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0002679GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010150GO-bp Annotation by Michelle Graham. GO Biological Process: leaf senescence SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0051607GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to virus SoyBaseN/AISS
GO:0051707GO-bp Annotation by Michelle Graham. GO Biological Process: response to other organism SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR19957Panther SYNTAXIN JGI ISS
PTHR19957:SF11Panther SYNTAXIN-RELATED JGI ISS
PF03168PFAM Late embryogenesis abundant protein JGI ISS
UniRef100_I1JQ77UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JQ77_SOYBN SoyBaseE_val: 7.00E-153ISS
UniRef100_Q8S8Z8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Syringolide-induced protein B13-1-9 n=1 Tax=Glycine max RepID=Q8S8Z8_SOYBN SoyBaseE_val: 1.00E-126ISS

Expression Patterns of Glyma03g35950
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g35950 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g201200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g35950
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g35950
>Glyma03g35950.1   sequence type=CDS   gene model=Glyma03g35950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGATTATAAGCAACACCACGGAAGAAGCTGCGGCTGCTGCTGCCTCTTTGGAATCTTGTGGAAGATTGTGGTTGCACTCATTGTCCTCGTTGGTCTTGTATTCCTCATATTTTGGCTGGTTGTTCAACCCCGCTACTTCAAGTTCCACGTCACGGAAGCGGACCTAACTCAATTTGAGTACTATCCAAACAACAACACCCTTCACTACAACATGGTCCTCAATTTCACTGCACGCAACCCCAACAAGAAGCTCAGCATATACTACGACAAAGTTGAGGCATTAGCATTCTACGAGGATGCCAGGTTCGCCAATTACGATGTCATAACTCACATGAACTCCTTCCGCCAGTACAAGAAGAGCACCAGTCCCATGAGCGCCGTTTTCTCGGGGCAGAAGGTGTTGATGCTCAACAACGAACAAGTCTCTCAGTTCAACCAAGACAAGAGTGTTGGAGCTTATGATATCTATGTGAAGCTCAACTTCAGGATTCGGTTCAGGCTCGGGGACTCGATTTCCCGTCACTTGAAGCCCAAGGTCAAATGTGATCTCAAGGTTCCCTTGAACAAAAGTGGCACCTTTACTCTGTTTCAGACCACCAAGTGCCATGTCAATGTCTAG
Predicted protein sequences of Glyma03g35950
>Glyma03g35950.1   sequence type=predicted peptide   gene model=Glyma03g35950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MADYKQHHGRSCGCCCLFGILWKIVVALIVLVGLVFLIFWLVVQPRYFKFHVTEADLTQFEYYPNNNTLHYNMVLNFTARNPNKKLSIYYDKVEALAFYEDARFANYDVITHMNSFRQYKKSTSPMSAVFSGQKVLMLNNEQVSQFNQDKSVGAYDIYVKLNFRIRFRLGDSISRHLKPKVKCDLKVPLNKSGTFTLFQTTKCHVNV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo