SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g35840): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g35840): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g35840

Feature Type:gene_model
Chromosome:Gm03
Start:42942117
stop:42944921
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g35840
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G36020AT Annotation by Michelle Graham. TAIR10: HVA22-like protein J | chr2:15123424-15125140 REVERSE LENGTH=258 SoyBaseE_val: 4.00E-62ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG1726 KOG HVA22/DP1 gene product-related proteins JGI ISS
PTHR12300Panther HVA22-LIKE PROTEINS JGI ISS
PTHR12300:SF20Panther HVA22-LIKE PROTEIN JGI ISS
PF03134PFAM TB2/DP1, HVA22 family JGI ISS
UniRef100_G7ZUV8UniRef Annotation by Michelle Graham. Most informative UniRef hit: HVA22-like protein i n=2 Tax=Medicago truncatula RepID=G7ZUV8_MEDTR SoyBaseE_val: 3.00E-93ISS
UniRef100_I1JQ71UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JQ71_SOYBN SoyBaseE_val: 2.00E-139ISS

Expression Patterns of Glyma03g35840
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g35840 not represented in the dataset
Glyma03g35840 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g35840
ParalogEvidenceComments
Glyma19g38500 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g35840 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g200400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g35840
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g35840
>Glyma03g35840.1   sequence type=CDS   gene model=Glyma03g35840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGGGGGATTTCATCATTCGATGTCTTATACTGATTCTGGGGTATGCGTATCCTGGATTTGAATGCTACAAAAGTGTGGAGCAAAACAGGGGTGACAATGGGGAACTTCGATTCTGGTGTCAATACTGGGTCATTGTAGCACTTTTCACAGTACTGGAGAATTTTACCGATGCAGTTATTGGATGGTGGTTTCCCTTATACGGAGAGTTGAAGCTTGCACTCTTTATCTACTTGTGGTATCCCAAAACTAAGGGGACGGGATATGTATATAATACTGTGCTGCGGCCTTATGTATCAAGCCATGAAAATGACATTGAGAAAAAGTTCCGAGAGTGGCGAGCTAGGGCATGGGATTTGGCCATTTTTTACTGGAAAAACTGCACAGAGTTGGGGCAAGCTACAACTTTCCAGATTCTCGACTATTTGGCTGCACAGTCTAAAAAATTCTCCAGCAAATCTTACTCTGAGAAAAAAGACAAGCTGGGTCCAACTCCAAGTGCCCCACCATTATCTTCACTTCGAGAAACTCTCTTTGAGAACAACCAAAACAAATTCCCAGGCCGCAAGAACAAGTAA
Predicted protein sequences of Glyma03g35840
>Glyma03g35840.1   sequence type=predicted peptide   gene model=Glyma03g35840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLGDFIIRCLILILGYAYPGFECYKSVEQNRGDNGELRFWCQYWVIVALFTVLENFTDAVIGWWFPLYGELKLALFIYLWYPKTKGTGYVYNTVLRPYVSSHENDIEKKFREWRARAWDLAIFYWKNCTELGQATTFQILDYLAAQSKKFSSKSYSEKKDKLGPTPSAPPLSSLRETLFENNQNKFPGRKNK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo