SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g35780

Feature Type:gene_model
Chromosome:Gm03
Start:42886089
stop:42887613
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g35780
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G11600AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: response to karrikin; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 12 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G06270.1); Has 171 Blast hits to 171 proteins in 15 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 171; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr3:3667337-3667690 FORWARD LENGTH=117 SoyBaseE_val: 1.00E-37ISS
GO:0080167GO-bp Annotation by Michelle Graham. GO Biological Process: response to karrikin SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1JQ64UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JQ64_SOYBN SoyBaseE_val: 1.00E-70ISS
UniRef100_Q9FNI1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Gb|AAF02129.1 n=1 Tax=Arabidopsis thaliana RepID=Q9FNI1_ARATH SoyBaseE_val: 2.00E-31ISS

Expression Patterns of Glyma03g35780
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g35780
ParalogEvidenceComments
Glyma19g38440 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g35780 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g199800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g35780
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g35780
>Glyma03g35780.2   sequence type=CDS   gene model=Glyma03g35780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTCGCAGAAACGAAAGTGGTCCAAAGCTTGACTTGAAGCTGAACCTGTCCCCACCGAGGGCTGATCGGAGACTGGATTCGCCGACACGATCGGCGACGGCGTCTCCGACGTCACCGCCGAGCTCGTGCGTGTCTTCGGAGCTGAACCAAGAGGACAAGAGTTACTCTAACAGCCCTGAAGCCACTTCCATGGTTCTTGTGGGTTGCCCTCGCTGCCTCATGTATGTGATGCTCTCTGAGGATGATCCAAAGTGCCCCAAATGCAAAAGCACCGTTTTGCTTGATTTCCTCCATGACACCAAAAACCCCACCATAAGGAGGAGTTAG
Predicted protein sequences of Glyma03g35780
>Glyma03g35780.2   sequence type=predicted peptide   gene model=Glyma03g35780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSRRNESGPKLDLKLNLSPPRADRRLDSPTRSATASPTSPPSSCVSSELNQEDKSYSNSPEATSMVLVGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHDTKNPTIRRS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo