Report for Sequence Feature Glyma03g35780
Feature Type: gene_model
Chromosome: Gm03
Start: 42886089
stop: 42887613
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma03g35780
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G11600 AT
Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: response to karrikin; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 12 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G06270.1); Has 171 Blast hits to 171 proteins in 15 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 171; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr3:3667337-3667690 FORWARD LENGTH=117
SoyBase E_val: 1.00E-37 ISS
GO:0080167 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to karrikin
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_I1JQ64 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JQ64_SOYBN
SoyBase E_val: 1.00E-70 ISS
UniRef100_Q9FNI1 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Gb|AAF02129.1 n=1 Tax=Arabidopsis thaliana RepID=Q9FNI1_ARATH
SoyBase E_val: 2.00E-31 ISS
Expression Patterns of Glyma03g35780
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma03g35780
Paralog Evidence Comments
Glyma19g38440 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma03g35780 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.03g199800 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma03g35780
Coding sequences of Glyma03g35780
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma03g35780.2 sequence type=CDS gene model=Glyma03g35780 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAGTCGCAGAAACGAAAGTGGTCCAAAGCTTGACTTGAAGCTGAACCTGTCCCCACCGAGGGCTGATCGGAGACTGGATTCGCCGACACGATCGGCGACGGCGTCTCCGACGTCACCGCCGAGCTCGTGCGTGTCTTCGGAGCTGAACCAAGAGGACAAGAGTTACTCTAACAGCCCTGAAGCCACTTCCATGGTTCTTGTGGGTTGCCCTCGCTGCCTCATGTATGTGATGCTCTCTGAGGATGATCCAAAGTGCCCCAAATGCAAAAGCACCGTTTTGCTTGATTTCCTCCATGACACCAAAAACCCCACCATAAGGAGGAGTTAG
Predicted protein sequences of Glyma03g35780
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma03g35780.2 sequence type=predicted peptide gene model=Glyma03g35780 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSRRNESGPKLDLKLNLSPPRADRRLDSPTRSATASPTSPPSSCVSSELNQEDKSYSNSPEATSMVLVGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHDTKNPTIRRS*