Glyma03g35700 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g35700

Feature Type:	gene_model
Chromosome:	Gm03
Start:	42813233
stop:	42815461
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g35700

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G36080	AT	Annotation by Michelle Graham. TAIR10: AP2/B3-like transcriptional factor family protein \| chr2:15148612-15151411 REVERSE LENGTH=244	SoyBase	E_val: 7.00E-60	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009062	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid catabolic process	SoyBase	N/A	ISS
GO:0045892	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0080167	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to karrikin	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
PF02362	PFAM	B3 DNA binding domain	JGI		ISS
UniRef100_B9SX03	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor, putative n=1 Tax=Ricinus communis RepID=B9SX03_RICCO	SoyBase	E_val: 5.00E-68	ISS
UniRef100_UPI000233729A	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233729A related cluster n=1 Tax=unknown RepID=UPI000233729A	SoyBase	E_val: 8.00E-169	ISS

Expression Patterns of Glyma03g35700

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g35700

Paralog	Evidence	Comments
Glyma19g38340	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g35700 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g199000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g35700

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g35700

Limit To All Plant Sequences

>Glyma03g35700.2   sequence type=CDS   gene model=Glyma03g35700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCATCGATAAACCACTATTCACCGGAAACAACACTATACTGGACCAACGACCAACAGCAACAAGCCGCCATGTGGCTGAGTAATTCCCACACCCCGCGTTTCAATCTGAACGACGAGGAGGAGGAGGAGGAAGACGACGTTATCGTTTCGGACAAGGCTACTAATAACTTGACGCAAGAGGAGGAGAAGGTAGCCATGTTCGAGAAGCCGTTGACGCCGAGCGACGTCGGGAAGCTGAACCGGCTCGTGATTCCGAAACAGCACGCGGAGAAGCACTTCCCTCTCGACTCGTCGGCGGCGAAGGGGCTGTTGCTGAGTTTCGAGGACGAGTCCGGGAAGTGTTGGCGCTTCCGTTACTCTTATTGGAACAGTAGCCAGAGTTACGTTTTGACCAAAGGATGGAGCCGTTACGTCAAAGACAAACGCCTCCACGCTGGCGACGTCGTTTTGTTCCACAGACACCGCTCCCTCCCTCAACGCTTCTTCATCTCCTGCAGCCGCCGCCAACCCAACCCGGTCCCCGCTCACGTTAGCACCACCAGATCCTCCGCTTCCTTCTACTCTGCGCACCCACCTTATCCTGCGCACCACTTCCCCTTCCCATACCAACCTCACTCTCTTCATGCACCAGGTGGAGGGTCCCAAGGACAGAACGAAACGACACCGGGAGGGAACAGTAGTTCAAGTGGCAGTGGCAGGGTGCTGAGGCTCTTTGGTGTGAACATGGAATGCCAACCTGATAATCATAATGATTCCCAGAACTCCACACCAGAATGCTCCTACACCCACTTATACCACCATCAAACCTCTTCTTATTCTTCTTCTTCAAACCCTCACCATCACATGGTACCTCAACAACCATAA

Predicted protein sequences of Glyma03g35700

Limit To All Plant Sequences

>Glyma03g35700.2   sequence type=predicted peptide   gene model=Glyma03g35700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSINHYSPETTLYWTNDQQQQAAMWLSNSHTPRFNLNDEEEEEEDDVIVSDKATNNLTQEEEKVAMFEKPLTPSDVGKLNRLVIPKQHAEKHFPLDSSAAKGLLLSFEDESGKCWRFRYSYWNSSQSYVLTKGWSRYVKDKRLHAGDVVLFHRHRSLPQRFFISCSRRQPNPVPAHVSTTRSSASFYSAHPPYPAHHFPFPYQPHSLHAPGGGSQGQNETTPGGNSSSSGSGRVLRLFGVNMECQPDNHNDSQNSTPECSYTHLYHHQTSSYSSSSNPHHHMVPQQP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain