SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g35690

Feature Type:gene_model
Chromosome:Gm03
Start:42806429
stop:42808504
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g35690
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G06240AT Annotation by Michelle Graham. TAIR10: embryo defective 2735 | chr5:1888380-1889512 FORWARD LENGTH=162 SoyBaseE_val: 1.00E-68ISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_D7LZ53UniRef Annotation by Michelle Graham. Most informative UniRef hit: EMB2735 n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LZ53_ARALL SoyBaseE_val: 2.00E-67ISS
UniRef100_I1JQ55UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JQ55_SOYBN SoyBaseE_val: 6.00E-115ISS

Expression Patterns of Glyma03g35690
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g35690
ParalogEvidenceComments
Glyma19g38320 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g35690 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g198800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g35690
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g35690
>Glyma03g35690.1   sequence type=CDS   gene model=Glyma03g35690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAGTGAGGGTTGTTTGCAGGAAAATTTACGACTACATACGCTATGATCTCAAAGAAATCTCTTTTCCCTCTTCTTTGCCAGACCCTCCTAACATCAAAAAGCGCCGCATATTGACCTGGGACGAACGTATCTGGGTTTTTAAGAGAGCTGCCAGGCTTTATGCCGCAAGCTGGGTTCGTGACATTGGTCCTGACCTTCGGCCTGATGATTATAAGAAGGATGATGACATGACTGATGAAACAAATGGTGAAAAGAAAACAACTAAAGGAAAAGAATCCTCAACACTGGAGGACCTTGCTGTAGCTGCAAGAGGGGGAATGGAGACTCTCAGACCGGCTTTGCAGCGTGTGTACATGACCAGAGCATCTGCATACAGAGATGCTCTTAAAAGTTTCATAGAAGGGTATCAAGAGGGTGTTCAGCAAGTAATGGAGAAGAAGGAAGATTCCAAAACTCAAGAAGATGCTGATCTACCCAAAAAATCAACTTGA
Predicted protein sequences of Glyma03g35690
>Glyma03g35690.1   sequence type=predicted peptide   gene model=Glyma03g35690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKVRVVCRKIYDYIRYDLKEISFPSSLPDPPNIKKRRILTWDERIWVFKRAARLYAASWVRDIGPDLRPDDYKKDDDMTDETNGEKKTTKGKESSTLEDLAVAARGGMETLRPALQRVYMTRASAYRDALKSFIEGYQEGVQQVMEKKEDSKTQEDADLPKKST*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo