Report for Sequence Feature Glyma03g35650
Feature Type: gene_model
Chromosome: Gm03
Start: 42787639
stop: 42789545
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma03g35650
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G06210 AT
Annotation by Michelle Graham. TAIR10: RNA binding (RRM/RBD/RNP motifs) family protein | chr5:1878497-1879515 FORWARD LENGTH=146
SoyBase E_val: 3.00E-44 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0000166 GO-mf
Annotation by Michelle Graham. GO Molecular Function: nucleotide binding
SoyBase N/A ISS
GO:0003676 GO-mf
Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding
SoyBase N/A ISS
GO:0003723 GO-mf
Annotation by Michelle Graham. GO Molecular Function: RNA binding
SoyBase N/A ISS
PTHR24012 Panther
FAMILY NOT NAMED
JGI ISS
PTHR24012:SF31 Panther
SUBFAMILY NOT NAMED
JGI ISS
PF00076 PFAM
RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
JGI ISS
UniRef100_B9SX10 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: RNA binding protein, putative n=1 Tax=Ricinus communis RepID=B9SX10_RICCO
SoyBase E_val: 1.00E-53 ISS
UniRef100_C6T383 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T383_SOYBN
SoyBase E_val: 2.00E-88 ISS
Expression Patterns of Glyma03g35650
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma03g35650 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.03g198500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma03g35650
Coding sequences of Glyma03g35650
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma03g35650.2 sequence type=CDS gene model=Glyma03g35650 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAATGAATATGGCGATGCAATACACACGCTCACTTGTTTTCCTTCGTCTCTGCAATTGAATTCCATGGCGGCCGTAAGAAAAATAATTGAGGTCAATAGAAATAAAATCTTGTCGCCATCTCTTCTCTCTTTTCGCCGGGGAATTGCTTACAAGCTTTTTGTTGGAGGATTGTCCTTCTACACCACAGAGAATGCATTATCAGAGGCATTCTCCAATTACGGGCAAGTTATTGAAGCCAAAATTGTAACAGATAGGGTGTCAGACAGATCTAAGGGATTTGGGTTTGTCACCTTTGCTTCTCAAGACGAGGCTGAGAATGCCATAGAAGATATGAAAGGAAAGACATTAAATGGACGTGTTATCTTTGTTGATTATGCAAAGCCCAATATCAACACTCGTGGTGAAATTCCAATTGCCAGAGGACCTCCTGAGCCAACATCAACACCAGATACTTGA
Predicted protein sequences of Glyma03g35650
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma03g35650.2 sequence type=predicted peptide gene model=Glyma03g35650 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MNEYGDAIHTLTCFPSSLQLNSMAAVRKIIEVNRNKILSPSLLSFRRGIAYKLFVGGLSFYTTENALSEAFSNYGQVIEAKIVTDRVSDRSKGFGFVTFASQDEAENAIEDMKGKTLNGRVIFVDYAKPNINTRGEIPIARGPPEPTSTPDT*